Recombinant Human IL23A&IL12B Heterodimer Protein (Active)

In Stock
Code CSB-MP6901HU
Abbreviation Recombinant Human IL23A&IL12B Heterodimer protein (Active)
MSDS
Size $256
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized Human IL23A&IL12B at 2 μg/ml can bind Anti-IL23A&IL12B recombinant antibody (CSB-RA011587MA2HU). The EC50 is 0.7293-0.8610 ng/mL. Biological Activity Assay
  • Activity
    IL23A&IL12B Recombinant Monoclonal Antibody captured on Protein A Chip can bind Recombinant Human IL23A&IL12B (CSB-MP6901HU) with an affinity constant of 0.158 nM as detected by MetaSPR Assay (WeSPRTM 200). Biological Activity Assay
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
①Measured by its binding ability in a functional ELISA. Immobilized Human IL23A&IL12B at 2 μg/mL can bind Anti-IL23A&IL12B recombinant antibody (CSB-RA011587MA2HU). The EC50 is 0.7293-0.8610 ng/mL.
②IL23A&IL12B Recombinant Monoclonal Antibody captured on Protein A Chip can bind Recombinant Human IL23A&IL12B (CSB-MP6901HU) with an affinity constant of 0.158 nM as detected by MetaSPR Assay (WeSPRTM 200).
Target Names
IL23A&IL12B
Uniprot No.
Alternative Names
/
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
20-189aa(IL23A) & 23-328aa(IL12B)
Target Protein Sequence
RAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSP&IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS
Mol. Weight
22.3 kDa & 37.7 kDa
Protein Length
Heterodimer
Tag Info
N-terminal 10xHis-tagged & C-terminal Twin-Strep-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

IL-23 drives Th17 differentiation and sustains chronic inflammatory responses, making precise quantification of its receptor engagement essential for modeling autoimmune pathology and evaluating therapeutic candidates. This heterodimeric protein demonstrates sub-nanomolar affinity (KD = 0.158 nM) to its cognate antibody in surface plasmon resonance assays and exhibits an EC50 of 0.73–0.86 ng/mL in functional ELISA, providing quantitative benchmarks for antibody development, epitope mapping, and competitive binding studies. Endotoxin levels below 1.0 EU/μg prevent LPS-driven artifacts in primary T cell differentiation assays, PBMC activation panels, and JAK/STAT signaling experiments where even trace contamination can confound cytokine-specific readouts. The protein spans residues 20–189 of IL-23A and 23–328 of IL-12B, preserving the mature heterodimer interface required for IL-23R engagement, and satisfies the purity criteria typical for use as an ELISA coating antigen, Western blot positive control, or immunogen in monoclonal antibody campaigns targeting IL-23-driven inflammatory pathways.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*