Recombinant Human Interleukin-25 (IL25)

Code CSB-MP875653HU
Abbreviation Recombinant Human IL25 protein
MSDS
Size $138
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Immunology
Alternative Names
Interleukin-17E
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
33-177aa
Target Protein Sequence
YSHWPSCCPSKGQDTSEELLRWSTVPVPPLEPARPNRHPESCRASEDGPLNSRAISPWRYELDRDLNRLPQDLYHARCLCPHCVSLQTGSHMDPRGNSELLYHNQTVFYRRPCHGEKGTHKGYCLERRLYRVSLACVCVRPRVMG
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
44.2 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal hFc1-tagged and C-terminal 10xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Induces activation of NF-kappa-B and stimulates production of the proinflammatory chemokine IL-8. Proinflammatory cytokine favoring Th2-type immune responses.
Gene References into Functions
  1. this review details the structural characteristics, expression patterns, responder cells, biological properties, and role of IL-25 in disease pathogenesis PMID: 30345318
  2. this study shows that IL-25 reduces Th17 cells and inflammatory responses in human peripheral blood mononuclear cells PMID: 29966691
  3. Endometrial stromal cells differentiate into decidual stromal cells in the presence of ovarian hormones, resulting in the upregulation of IL25/IL17RB expression in endometrial stromal cells. PMID: 29257317
  4. In conclusion, the findings of the present study suggest that IL-25 but not IL-33 might contribute to the pathogenesis of chronic eosinophilic inflammation of the lung in patients with CEP. PMID: 28875265
  5. Nasal Il-25 is overexpressed in patients with chronic rhinosinusitis with nasal polyps and airway hypersensitiveness. PMID: 28870448
  6. IL-25-induced activation of nasal fibroblast and its association with the remodeling of chronic rhinosinusitis with nasal polyposis PMID: 28771607
  7. The authors concluded that IL-25 provides protection from amebiasis, which is dependent upon intestinal eosinophils and suppression of TNF-alpha. PMID: 28246365
  8. Inhibition of IL-25 resulted in decreased type 2 T cells and macrophages in the primary tumor microenvironments, both reported to enhance breast tumor invasion and subsequent metastasis to the lung. PMID: 27909985
  9. Our findings suggest that the IL-25/IL-25R axis may play an important role in promoting the recruitment and proinflammatory function of eosinophils in allergic asthma. PMID: 27685606
  10. Chronic rhinosinusitis with nasal polyps (CRSwNP) epithelial cells release TSLP and IL-25 when stimulated by poly(I:C) but not by DP or AF, suggesting that viral infection may contribute to maintain and amplify the T2 immune response seen in CRSwNP. PMID: 28127565
  11. Increased induction and expression of TSLP, IL-25, and IL-33 from nasal epithelial cells contribute to the pathophysiology of eosinophilic chronic rhinosinusitis. PMID: 26540312
  12. Women with endometriosis showed significantly higher levels of IL-25 in their PF (p=0.019) compared to controls. IL-25 levels did not correlate with the stage of endometriosis. PMID: 26852387
  13. IL-8 and IL-25 are targets of miR-20b. PMID: 26845056
  14. Our findings indicate that the alarmin cytokines IL-33 and IL-25 increase basophil activation and migratory potential, and may pose as a novel therapeutic targets for the treatment of allergic asthma. PMID: 26762527
  15. The IL17E rs79877597 SNP was a modifier of the risk for psoriasis disease severity and psoriatic arthritis. PMID: 26347322
  16. Findings indicate that the release of interleukin 25 (IL-25) from tumour-associated fibroblasts (TAFs) may serve as a check point for control of mammary tumour metastasis. PMID: 27089063
  17. IL-25 upregulated PD-L1 surface expression through the signaling pathways of JNK and STAT3, with STAT3 found to constitutively occupy the proximal region of the PD-L1 promoter. PMID: 26321145
  18. we have demonstrated that the expression of ET-1 and IL-25 was coordinately upregulated in the lesional keratinocytes of patients with AD and a murine AD model. PMID: 25903653
  19. IL-25 overexpression was observed in eosinophilic chronic rhinosinusitis and may serve as a mediator of eosinophilic CRS. PMID: 25975248
  20. expression of immunoreactivity for IL-17A, IL-17RA, IL-17E, and IL-17F was significantly elevated in prostatic tissue from benign prostatic hyperplasia and prostate cancer compared with that in controls PMID: 26356122
  21. This article focuses on evidence for the role of IL-25, IL-33 and TSLP in human allergic disease; although this triad of cytokines is described as epithelial derived, it is clear that their expression within lung tissue is much more widespread.[Review] PMID: 25705788
  22. The levels of mRNA for IL-25 were not significantly elevated in parotid gland tissues from Kimura Disease patients as compared to controls. PMID: 25676453
  23. asthmatic epithelial cells have an increased intrinsic capacity for expression of a pro-type 2 cytokine in response to a viral infection, and IL-25 is a key mediator of RV-induced exacerbations of pulmonary inflammation PMID: 25273095
  24. increased levels in patients with chronic rhinosinusitis with nasal polyps PMID: 25704964
  25. Because IL-25 has a major role in triggering type 2 responses, bronchial epithelial IL-25 expression is likely a key determinant of type 2 response activation in asthma PMID: 25133876
  26. Human chorionic gonadotropin up-regulates Il25, promoting the proliferation of decidual stromal cells by activation of JNK and AKT signal pathways. PMID: 24746746
  27. Patients with the 'IL-5, IL-17A, IL-25-high' airway inflammatory pattern are often uncontrolled asthmatics, despite daily treatment. PMID: 23957336
  28. IL-25 and type 2 innate lymphoid cells have roles in development of pulmonary fibrosis PMID: 24344271
  29. IL-25 expression is markedly reduced during human and experimental fulminant hepatitis. PMID: 23564603
  30. IL-25 and IL-33-driven type-2 innate lymphoid cells have roles in atopic dermatitis PMID: 24323357
  31. IL-25 enhances herpes simplex virus (HSV)-1 and vaccinia virus replication by inhibiting filaggrin expression, and IL-25 acts synergistically with IL-4 and IL-13 to enhance HSV-1 replication in vitro PMID: 23657503
  32. Suggest that IL-25 production by airway epithelial cells is regulated by the transcription and protein release levels and that allergen proteases likely play pivotal roles in both biological processes. PMID: 23590308
  33. Our data demonstrate that IL-33 plays a critical role in the rapid induction of airway contraction by stimulating the prompt expansion of IL-13-producing type 2 innate lymphoid cells, whereas IL-25-induced responses are slower and less potent. PMID: 23810766
  34. IL-25 Is Decreased in Sera of Patients With inflammatory bowel disease. PMID: 23429464
  35. IL-25 secreted from epithelial cells has the potential to promote airway remodeling in asthma. PMID: 22691357
  36. We observed significant downregulation of IL-25 in women with recurrent miscarriage compared with controls. PMID: 22266274
  37. IL-25 production is differently regulated by TNF-alpha and TGF-beta1 in the human g PMID: 20944558
  38. production is linked to the amount of specific IgE antibodies in blood samples of 6 yr old children in Germany PMID: 20492545
  39. Findings suggest that IL-25 is elevated in asthma and contributes to angiogenesis. PMID: 21205894
  40. IL-25 may have a role in atopic dermatitis PMID: 20861853
  41. Eosinophils are the main source of IL-25, whereas activated CD4+ memory T cells are the IL-17RB-expressing cells in Churg-Strauss syndrome. PMID: 20729468
  42. IL-17A and IL-25 had opposing effects on thymic stromal lymphopoietin regulation in human nasal epithelial cells PMID: 19968632
  43. Overexpression of IL-17E up-regulates gene expression of Th2 cytokines and induces growth retardation, jaundice, and multiorgan inflammation in a transgenic mouse model. PMID: 11714825
  44. Transgenic overexpression from humans into mice results in eosinophilia, B-lymphocyte hyperplasia, and altered antibody production. PMID: 12239140
  45. IL-17E may contribute to the induction and maintenance of eosinophilic inflammation by acting on lung fibroblasts. This supports a role for IL-17E in asthma pathophysiology. PMID: 16522458
  46. IL-25 acts by amplifying TH2 cell-mediated allergic airway inflammation. IL-25 itself does not significantly induce allergic inflammation in vivo. PMID: 16950278
  47. IL-25 produced by innate effector eosinophils and basophils may augment the allergic inflammation by enhancing the maintenance and functions of TSLP-DC activated adaptive Th2 memory cells PMID: 17635955
  48. The upregulation of costimulation-induced IL-25 receptors and release of cytokines and chemokines from IL-25 treated costimulated Th cells were differentially regulated by intracellular JNK, p38 MAPK and NF-kappaB activity. PMID: 17719653
  49. Blocking IL-25 in an experimental model of allergic asthma prevents airway hyperresponsiveness, a critical feature of clinical asthma. PMID: 17889290
  50. Higher expressions of IL-17E, IL-17A, IL-17BR and IL-17R are associated with oral inflammation. PMID: 19095584

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
IL-17 family
Tissue Specificity
Expressed at low levels in several tissues, including brain, kidney, lung, prostate, testis, spinal cord, adrenal gland, and trachea.
Database Links

HGNC: 13765

OMIM: 605658

KEGG: hsa:64806

STRING: 9606.ENSP00000328111

UniGene: Hs.302036

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*