Recombinant Human Interstitial collagenase(MMP1),partial

In Stock
Code CSB-RP070094h
Size US$1726
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-RP070094h could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) MMP1.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-RP070094h could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) MMP1.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 90% as determined by SDS-PAGE.
Target Names MMP1
Uniprot No. P03956
Research Area Developmental Biology
Alternative Names 27 kDa interstitial collagenase; CLG; CLGN; collagenase; fibroblast; collagenase; interstitial; Fibroblast collagenase; Interstitial collagenase; Matrix metallopeptidase 1 (interstitial collagenase); Matrix metalloprotease 1; Matrix Metalloproteinase 1; Matrix metalloproteinase-1; MMP 1; MMP-1; MMP1; MMP1_HUMAN; OTTHUMP00000045866
Species Homo sapiens (Human)
Source E.coli
Expression Region 101-469aa
Target Protein Sequence VLTEGNPRWEQTHLTYRIENYTPDLPRADVDHAIEKAFQLWSNVTPLTFTKVSEGQADIMISFVRGDHRDNSPFDGPGGNLAHAFQPGPGIGGDAHFDEDERWTNNFREYNLHRVAAHELGHSLGLSHSTDIGALMYPSYTFSGDVQLAQDDIDGIQAIYGRSQNPVQPIGPQTPKACDSKLTFDAITTIRGEVMFFKDRFYMRTNPFYPEVELNFISVFWPQLPNGLEAAYEFADRDEVRFFKGNKYWAVQGQNVLHGYPKDIYSSFGFPRTVKHIDAALSEENTGKTYFFVANKYWRYDEYKRSMDPGYPKMIAHDFPGIGHKVDAVFMKDGFFYFFHGTRQYKFDPKTKRILTLQKANSWFNCRKN
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 46.5kDa
Protein Length Partial
Tag Info N-terminal 6xHis-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Target Data

Function Cleaves collagens of types I, II, and III at one site in the helical domain. Also cleaves collagens of types VII and X
Gene References into Functions
  1. For MMP-1(-1607) 1G/2G, a significant association was observed using the recessive genetic model. In the subgroup studies, a significant association was observed in the Asian subgroup (OR = 1.68; for the recessive model; and OR = 1.59; for the allelic contrast model) and in the European subgroup (OR = 0.65; for the allelic contrast model). PMID: 30117779
  2. rs1799750 in MMP1 might be a risk factor for rheumatic heart disease in a Han population in Southern China, and individuals carrying the 2G/2G genotype are likely more susceptible to rheumatic heart disease. PMID: 29458338
  3. RHCG Suppresses Tumorigenicity and Metastasis in Esophageal Squamous Cell Carcinoma via Inhibiting NF-kappaB Signaling and MMP1 Expression. PMID: 29290801
  4. Malignant extracellular vesicles carrying MMP1 mRNA facilitate peritoneal dissemination in ovarian cancer. PMID: 28262727
  5. Data suggest that matrix metalloproteinase-1 and neutrophil elastase may be important but heretofore unrecognized players in stimulating uterine contractions at the time of labor, and they may explain why indomethacin delays, but does not prevent, preterm labor because indomethacin inhibits the prostaglandin component but not the protease component of labor. PMID: 28954603
  6. the present study demonstrated that scopoletin inhibited MMP1 and proinflammatory cytokine expression by inhibiting p38 MAPK phosphorylation. PMID: 30015831
  7. Matrix metalloproteinase 1(MMP1), which was downregulated in myelodysplastic syndromes (MDS)-mesenchymal stromal cells (MSCs), was identified as an inhibitory factor of MDS cell proliferation. PMID: 28262842
  8. study to explore the relationship between 2 polymorphisms (MMP-1-755 T/G [rs498186] and MMP-3 A/C [rs632478]) and disc degeneration; no significant association of the MMP-1 polymorphism with disc degeneration was found PMID: 28497435
  9. Expression of GSDMC is increased by UV irradiation in human skin keratinocytes. GSDMC induction contributes to the increase of MMP-1 expression specifically via activation of ERK and JNK pathways. PMID: 29428815
  10. our results suggest that the typical 1G/2G MMP-1 polymorphic site did not play a direct determinant role in breast cancer among Taiwanese women. PMID: 29695550
  11. The maternal and fetal 1G/1G MMP1 gene polymorphisms may be strong genetic markers of preeclampsia, occurring either individually or together. PMID: 29670668
  12. The current study indicated that MMP1 has a key role in the regulation of cervical tumor growth and lymph node metastasis via epithelial mesenchymal transition to a certain extent PMID: 29436615
  13. 2G allele of MMP-1, C allele of MMP-2 and 5A/6A genotype of MMP-3 are associated with susceptibility and disease progression of type 2 diabetic nephropathy PMID: 29883760
  14. this study provides insights into the development of a possible alternative therapy manipulating MMP-1 and the mTOR signaling pathway in Epidermal growth factor receptor-tyrosine kinase inhibitor-resistant lung adenocarcinoma. PMID: 29463039
  15. Specific silencing that targeted AMPK resulted in the enhancement of mobility and contractility and in the production of MMP-1 and MMP-2. PMID: 29122080
  16. MMP-1 genotype may accelerate the development of HIV-associated neurocognitive disorder (HAND) whereas MMP3 -1612 5A5A genotype may reduce the risk of pathogenesis of HAND. PMID: 29358561
  17. Authors observed a significant increase in the immunoexpression of collagen I and III in patients with DCM and a significant reduction in the immunoexpression of MMP-1 compared with the control group. Also, the collagen I and TIMP-1 expression indicated a positive linear correlation and respectively a negative linear relationship with collagen III and MMP-1. PMID: 29250654
  18. findings suggest that the polymorphic genotypes at MMP-1 promoter -1607 may play a major role in determining personal cancer susceptibility for prostate cancer in Taiwan PMID: 29970511
  19. No significant association was found between MMP-1 (-16071G/2G, -519A/G) variants and obesity. PMID: 29317790
  20. Reduced expression of types I and III collagen and TIMP-1 as well as the increased expression of MMP-1 and MMP-8 in the anterior vaginal wall tissues play important roles in the onset of pelvic organ prolapse. PMID: 29263043
  21. The results of the present study suggested that miR93 regulated MMP1 and collagen I expression in fibroblasts via calpain2. miR93 mediated collagen expression in stress urinary incontinence via calpain2. PMID: 29115452
  22. This study demonstrates that matrix remodeling caused by matrix metalloproteinase (MMP)-1 regulates phenotypic activities and modulates radiosensitivity of hepatocarcinoma cells exclusively in a 3D matrix. In response to MMP-1, liver cancer cells undergo active proliferation, downregulation of E-cadherin, and the loss of detoxification capacity. PMID: 28683186
  23. Results suggested that miR-361 directly inhibited MMP-1 expression by binding to its 3'-UTR suppressing breast cancer cells invasion and metastasis. PMID: 29132384
  24. Review/Meta-analysis: MMP-1 -1607 1G/2G and MMP-12 -82 A/G gene polymorphisms are associated with ischemic stroke risk. PMID: 28958661
  25. Results show that head and neck squamous cell carcinoma tumors with low P120CTN and PI3K pathway mutations have higher levels of MMP1 compared to tumors with high P120CTN and no PI3K pathway mutations demonstrating that P120CTN downregulation and PIK3CA mutations promote MMP1-driven invasion. PMID: 28637905
  26. MMP-1 (and MMP-2 and MMP-3) are independently associated with markers of arterial stiffening in patients with type 1 diabetes. PMID: 29070037
  27. There was no statistically significant difference in the distribution of the MMP1-1607dupG (rs1799750) polymorphism between patients with unstable angina and the control group. PMID: 29044936
  28. PTEN inhibits replicative senescence-induced MMP-1 expression by regulating NOX4-mediated reactive oxygen species in human dermal fibroblasts. PMID: 28557373
  29. None of the studied polymorphisms showed statistically significant association with the risk of varicose veins of the lower extremities. PMID: 28944430
  30. Matrix metalloproteinase 1 rs1799750 polymorphism was significantly associated with nasopharyngeal carcinoma risk in the subgroup analysis by smoking, a marginally significant association was found in non-smokers. PMID: 29096757
  31. Studied the association between the matrix metalloproteinase-1 (MMP-1) 1607 1G/2G polymorphism and susceptibility to spinal tuberculosis in Southern Chinese Han population. PMID: 28129430
  32. MMP1 was consistently and significantly upregulated in the induced pluripotent stem cells-derived endothelia from autosomal dominant polycystic kidney disease patients with intracranial aneurysms compared with the patients without intracranial aneurysms in multiple assays, indicating that high serum MMP1 levels may be a novel risk factor. PMID: 27418197
  33. rs1144393 in the MMP1 promoter region can be a predictor of grade >/= 2 RILI in lung cancer patients treated with thoracic radiation. PMID: 27659527
  34. The present results suggested that Icariin may have a chondroprotective effect, exerted through the inhibition of MMP1, MMP3 and MMP13 via MAPK pathways. Therefore, Icariin may have potential as a novel therapeutic strategy for the treatment of osteoarthritis. PMID: 28447732
  35. proteolysis of collagen-rich natural extracellular matrix (ECM), performed uniquely by individual homologous proteases, leads to distinct events that eventually affect overall ECM morphology, viscoelastic properties, and molecular composition. PMID: 27630193
  36. SAA1 can be a potential mediator for UV-induced MMP-1 expression in human skin. PMID: 26900010
  37. collagen II-activated phosphorylated-DDR2 induces CYR61 through activation of transcription factor activator protein 1 (AP-1). The elevated CYR61, in turn, accelerates MMP1 production via ETS1 (ETS proto-oncogene 1). PMID: 27653023
  38. M. tuberculosis infection caused enhanced MMP-1, -9, and miR-223 expression, with inhibited BMAL1 expression. MiR-223 modulated BMAL1 expression via the direct binding of BMAL1 3'-UTR. PMID: 28543681
  39. 20(S)-PPD treatment modulated MMP-1 mRNA expression and the transcriptional activity of activator protein (AP)-1, a major transcription factor of MMP-1. PMID: 28379603
  40. This is the first study to indicate that the genotypes of MMP1 promoter -1607, do not significantly confer susceptibility to lung cancer in a Taiwanese population. PMID: 29277780
  41. Matrix metalloproteinase-1, -8, -9 and the risk of cardiovascular complications in patients with CHD before and after myocardial revascularization. PMID: 29215835
  42. Results show that the expression level of MMP1 and TIMP1 is under the regulation of HAS2 leading to migration, invasion and EMT of oral cancer cells. PMID: 27884164
  43. DDC up-regulated MMP-1 in LX-2 cells through the Akt and ERK/miR-222/ETS-1 pathways. PMID: 27412967
  44. Meta-analysis of existing data showed that rs1799750 may affect individual susceptibility to glaucoma. PMID: 27428613
  45. results suggest that MMP1-1607 1G/2G, MMP3-1171 5A/6A and MMP9-1562 C/T gene polymorphisms have synergistic effect on breast cancer. The interactions of MMPs clinical risk factors such as lymph node involvement has shown a strong correlation and might influence the 5-years survival rate, suggesting their potential role in the breast carcinogenesis PMID: 28961241
  46. The MMP-1 -1607 (2G/1G) and -519 (A/G) polymorphisms may contribute to the onset of osteomyelitis. The 2G/2G genotype carriers had 1.605 times risk of developing osteomyelitis. In addition, frequency of -519GG genotype was obviously higher in case group than that in control group, and GG genotype related to an increased risk of osteomyelitis. Whereas, the -519G allele may be a susceptible factor for osteomyelitis. PMID: 29049163
  47. No differences in the distribution of the MMP-1 variants were found among Tunisian chronic obstructive pulmonary disease patients and healthy controls. Additionally, no significant association was retrieved between clinicopathologic parameters of chronic obstructive pulmonary disease, MMP-1 levels and this polymorphism. PMID: 27412345
  48. In American cutaneous leishmaniasis caused by Leishmania braziliensis infection, MMP1 is regulated by factors other than FLI1, and the influence of IL-6 on MMP1 was independent of its effect on FLI1. PMID: 28119029
  49. MMP1 was produced in the tumor compartment of prostate cancer bone metastases, highlighting its accessibility to KLK4 at this site PMID: 27378148
  50. EREG and MMP-1 were found to be elevated in nasal polyp and uncinate tissues in patients with Chronic rhinosinusitis with nasal polyps. PMID: 28398769
  51. IL-21 levels in rheumatoid arthritis synovial fluid were associated with matrix metalloproteinase (MMP)-1 and MMP-3. PMID: 27733582
  52. Data indicate that MMP1, MMP12 and PPARG and hsa-miR-31-5p, hsa-miR-224-5p, and hsa-miR-223-3p were able to distinguish tumors from NPT with high sensitivity and specificity. PMID: 28122331
  53. we infer that Slug enhances MMP1 transcription via directly binding to the promoter region in breast cancer cells, which is a previously unrecognized mechanism in the development of multi-drug resistance. PMID: 28334049
  54. Increased levels of MMP1 and MMP12 on tumor-associated macrophages in the peripheral areas of dermatofibrosarcoma protuberance might contribute to local invasion PMID: 28551623
  55. The genetic polymorphism of MMP-1 and MMP-3 is associated with rotator cuff tear. Individuals with haplotype 2G/5A were more susceptible to rotator cuff tears in the population studied. PMID: 28160256
  56. association among MMP-1 polymorphisms -422A/T and -519A/G with long-term prognosis in patients after ST elevation myocardial infarction treated by primary PCI PMID: 28101856
  57. Plasma levels of MMP-1, MMP-8, and MMP-9 are associated with COPD severity and can be used as a biomarker to better understand the characteristics of COPD patients. PMID: 27313452
  58. 1G/2G genotype of MMP1 promoter 1607 may have a protective effect on oral cancer risk for smokers. PMID: 27381606
  59. MMP1 promotes tumor growth and metastasis in esophageal squamous cell carcinoma via PI3K/Akt signaling pathway. PMID: 27130665
  60. Interacting post-muscarinic receptor signaling pathways potentiate MMP1 expression and invasion of human colon cancer cells. PMID: 28008134
  61. The results suggest that SNPs in the MMP-1 gene might not be useful as significant markers for predicting KBD susceptibility in Chinese Han population PMID: 27245218
  62. Oxytocin prevents cartilage matrix destruction via regulating MMP1 and MMP13. PMID: 28238786
  63. the overexpression of HMGB1 A-box significantly decreased the IL-1beta-stimulated the production of MMP-1, MMP-3 and MMP-9, and also reduced the elevated levels of inducible nitric oxide synthase (iNOS) and cyclooxygenase-2 (COX-2) associated with the inhibition of prostaglandin E2 (PGE2) and nitric oxide (NO) production in IL-1beta-stimulated chondrocytes. PMID: 27771306
  64. Up-regulation of MMP-1/MMP-3 by IL-1beta and/or TNF-alpha in a fraction of chondrocytes in vitro suggests that a subpopulation of catabolic cells may also exist in osteoarthritis. PMID: 25291965
  65. The 1G allele of matrix metallopeptidase 1 (MMP1) promoter 1607 may have a protective effect on hepatocellular carcinoma (HCC) risk for non-smokers in Taiwan. PMID: 28387651
  66. The status of a carrier of mutated (G insertion) allele with regard to the 1G/2G polymorphism at position -1607 within the MMP1 gene may determine a pathological phenotype associated with a more severe clinical course of chronic rhinosinusitis with nasal polyps PMID: 26926305
  67. Study investigated the association between MMP-1 -1607 1G/2G and MMP-3 -1171 5A/6A genetic polymorphisms and etiological subtypes of ischemic stroke (IS) in the Han Chinese population; MMP-1 2G allele was associated with IS due to SAO, whereas patients with IS due to LAA were more likely carriers of the 5A variant in MMP-3 PMID: 27793533
  68. this study shows that sICOSL in the serum of healthy donors increases in an age-dependent manner and that the matrix metalloproteinase inhibitor (MMPI) could suppress sICOSL production PMID: 27138044
  69. In order to reveal the structural and conformational effects of mutations, a molecular dynamics (MD) study was performed of in silico mutated residues in the X-ray crystallographic structure of MMP-1 complexed with a collagen-model triple-helical peptide (THP). The results indicate an important role of the mutated residues in MMP-1 interactions with the THP and communication between the catalytic and the HPX domains. PMID: 27754420
  70. A significant association has been found between MMP-1 -1607 1G/2G polymorphism and the susceptibility of endometriosis and adenomyosis under recessive model, while no significant association was found for MMP-2 -735 C/T, MMP-3 -1171 5A/6A and MMP-9 -1562 C/T polymorphisms. (Meta-analysis) PMID: 27659332
  71. infiltrative pulmonary tuberculosis is characterized by impairements in the system MMP/inhibitors: the levels of MMP-1, -9 increased, MMP-3, -8, TIMP-1 remained at the reference values and a 2-macroglobulin was low. PMID: 27797337
  72. Serum MMP-1 level showed a possibility as a prognostic biomarker in non-small cell lung cancer. PMID: 26995105
  73. MMP1 expression is significantly upregulated in human masticatory mucosa during wound healing PMID: 28005267
  74. Increased expression of TREM-1 in S compared to AS patients involving TNFa, MMP-1 and MMP-9 suggest a potential role of TREM-1 in plaque destabilization PMID: 27017522
  75. Study suggests no association between MMP polymorphisms and systemic sclerosis susceptibility; although, genotypes from MMP1 -1607 1G/2G and MMP3 -1171 5A/6A polymorphisms were associated with specific clinical features of the disease. PMID: 28002595
  76. MiR-202-3p may function as a novel pro-fibrotic miRNA in SSc by inhibition the expression of MMP1. PMID: 28068631
  77. BANCR is highly expressed in type 1 endometrial cancer (EC) tissue and promotes EC-cell proliferation, migration, and invasion by activating ERK/MAPK signaling pathway that regulates MMP2/MMP1 expression. PMID: 27898420
  78. No association was found between the MMP-1 polymorphism and disc degeneration and MMP-1 expression. PMID: 27706715
  79. MMP-1 rs1799750 may be involved in the development of coexisting type 2 diabetes mellitus (T2DM) and coronary heart diseasein the Han Chinese population PMID: 27323171
  80. Based on our meta-analysis, MMP-9 rs3918242 T is correlated with susceptibility to COPD, but MMP-1 rs1799750 2G and MMP-3 rs3025058 5A are not. These results should be further confirmed using a larger sample size PMID: 27173221
  81. OA causes NO production by inducing the inducible nitric oxide synthase overexpression, thereby promoting the secretions of matrix metalloproteinases-1 (MMP-1) and MMP-3. PMID: 27072559
  82. results suggest MMP 1 serum levels and polymorphism as potential independent prognostic markers for future cardiovascular events. PMID: 27693213
  83. We found that the 1G/1G homozygous and 1G/2G heterozygous genotypes of MMP1 rs1799750 were significantly associated with a lower susceptibility to childhood acute lymphoblastic leukemia PMID: 27798872
  84. the expression of MMP-1, MMP-2, TIMP-1, and TIMP-2 genes is important for the pathogenesis of periapical inflammatory lesions. PMID: 26293377
  85. Increased expression of MMP-1 and MMP-9 suggests they have an important role in the pathogenesis of varicose vein. PMID: 26960630
  86. The 1G/1G genotype of MMP-1 promoter -1607 may independently have a protective effect on NPC risk, without interaction with behavioral factors, including cigarette, alcohol and areca consumption. PMID: 27354591
  87. The genotype of MMP1 promoter 1607 may not be a major determining factor for breast cancer risk. PMID: 27354592
  88. The MMP1-1607 SNP was identified as a risk factor for periapical lesions development, possibly due to its association with increased MMP-1 mRNA levels in periapical lesions. PMID: 27556208
  89. The knock-down of MMP1 in MDA-MB231 spheroids and pharmacological inhibition of PAR1 in LECs inhibited CCID formation by ~30%. Intracellular Ca(2+) release in LECs, which was induced by recombinant MMP1, was suppressed by the PAR1 inhibitor SCH79797, thereby confirming a functional intercellular axis: RELA/NFKB1 - MMP1 (MDA-MB231) - PMID: 26513020
  90. ZBP-89 regulates of MMP-1 expression in response to inflammatory cytokines. PMID: 26891870
  91. These observations suggest a novel role of BMP-6 in the inhibition of breast cancer metastasis by regulating secretion of MMPs(MMP-1) in the tumor microenvironment. PMID: 26751737
  92. MMP-1 expression is increased in intervertebral disc degeneration, with higher expression observed in more severe cases, whereas TIMP-1 expression was similarly expressed in both normal and degenerated discs. PMID: 26782559
  93. These results demonstrated widespread alterations of matrix metalloproteinase 1 expression in Multiple System Atrophy. PMID: 26260627
  94. MMP-1 haplotypes association with susceptibility and severity of juvenile idiopathic arthritis PMID: 26510114
  95. Cross-talk between macrophages and smooth muscle cells impairs collagen synthesis and MMP1/9 activity, promoting angiogenesis. PMID: 27060293
  96. the serum levels of MMP-2 and MMP-9 proteins were higher in patients with OA than in controls, while MMP-1 and MMP-9 protein expressions were higher in the synovial joint fluid of patients with osteoarthritis than in controls. PMID: 26600542
  97. The -1607 1G/2G polymorphism of MMP-1 promoter may be related to the susceptibility to ADDWOR with or without TMJ OA. PMID: 26363461
  98. For the MMP1 -1607 1G/2G polymorphism, a negative association was identified for the 2G allele in bladder cancer PMID: 26301605
  99. Data show that blocking the interleukin-8 (IL-8)/androgen receptor (AR)/matrix metalloproteinases (MMPs) signals partially reversed the infiltrating B cells capacity to increase the bladder cancer (BCa) cell invasion. PMID: 26305549
  100. determined normal concentration ranges for MMP-1, MMP-2, MMP-9, TIMP-1, and ratios of concentrations of MMPs and TIMP-1 (MMP-1/TIMP-1, MMP-2/TIMP-1, MMP-9/TIMP-1) in the amniotic fluid at the first period of labor in physiological pregnancy. PMID: 26973196

Show More

Hide All

Subcellular Location Secreted, extracellular space, extracellular matrix
Protein Families Peptidase M10A family
Database Links

HGNC: 7155

OMIM: 120353

KEGG: hsa:4312

STRING: 9606.ENSP00000322788

UniGene: Hs.83169

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2020 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1