Recombinant Human Kallikrein-10 (KLK10), partial

In Stock
Code CSB-EP012447HU1
Abbreviation Recombinant Human KLK10 protein, partial
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
KLK10
Uniprot No.
Research Area
Cell Cycle
Alternative Names
Breast normal epithelial cell associated serine protease; Kallikrein related peptidase 10; Kallikrein-10; Kallikrein10; KLK 10; KLK10; KLK10_HUMAN; NES 1; NES1; Normal epithelial cell specific 1; Normal epithelial cell-specific 1; Protease serine like 1; Protease serine-like 1; PRSS L1; PRSSL 1; PRSSL1
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
31-274aa
Target Protein Sequence
AEAALLPQNDTRLDPEAYGSPCARGSQPWQVSLFNGLSFHCAGVLVDQSWVLTAAHCGNKPLWARVGDDHLLLLQGEQLRRTTRSVVHPKYHQGSGPILPRRTDEHDLMLLKLARPVVLGPRVRALQLPYRCAQPGDQCQVAGWGTTAARRVKYNKGLTCSSITILSPKECEVFYPGVVTNNMICAGLDRGQDPCQSDSGGPLVCDETLQGILSWGVYPCGSAQHPAVYTQICKYMSWINKVIR
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
30.8kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Has a tumor-suppressor role for NES1 in breast and prostate cancer.
Gene References into Functions
  1. MiR-199b-5p promotes cell proliferation, migration and suppresses apoptosis in cervical cancer cells. KLK10 is a direct target of miR-199b-5p. MiR-199b-5p expression is increased and positively correlated with KI-67 in human cervical cancer tissues and cell lines. PMID: 29807015
  2. blockade of KLK10 attenuates epithelial-mesenchymal transition and activation of FAK-SRC-ERK signaling, which explains the mechanism of KLK10 in promoting metastasis. PMID: 29621546
  3. To the best of our knowledge, this is the first report on KLK10 exon 3 unmethylated PCR product concentration as potential early epigenetic diagnostic marker in primary ovarian tumors. PMID: 29690914
  4. KLK10 was verified to be a potential therapeutic target for reversing trastuzumab resistance in breast cancer cells. PMID: 27825132
  5. Pronounced correlations between KLK10/KLK11 (rs = 0.647) and between KLK9/KLK15 (rs = 0.716) mRNA, but not between other combinations, indicate coordinate expression of distinct pairs of peptidases PMID: 29095848
  6. identification and molecular cloning of eight novel transcripts of the human KLK10 gene using 3' rapid amplification of cDNA ends (3' RACE) and next-generation sequencing (NGS), as well as their expression analysis in a wide panel of cell lines, originating from several distinct cancerous and normal tissues PMID: 28419837
  7. Data suggest that mature KLK9 (kallikrein 9) is a glycosylated chymotrypsin-like enzyme with strong preference for tyrosine over phenylalanine at P1 cleavage position; substrate specificity of KLK9 appears to extend to KLK10 and midkine; enzyme activity is enhanced by Mg2+ and Ca2+, but is reversibly attenuated by Zn2+; KLK9 is inhibited in vitro by many naturally occurring or synthetic protease inhibitors. PMID: 28559305
  8. KLK10 potentially plays a crucial role in esophageal cancer cell growth. PMID: 26479703
  9. KLK10 may function as a tumour suppressor by repressing proliferation, enhancing apoptosis and decreasing glucose metabolism in PC3 cells. PMID: 26616394
  10. treated and untreated prolactin-producing pituitary adenomas and carcinomas as well as TSH-producing pituitary adenomas and carcinomas were conclusively immunopositive for KLK10 PMID: 25553760
  11. Immunoexpression of KLK10 in the ACTH-secreting tumors as well as in the Crooke cell tumors was significantly increased when compared with the nonfunctioning tumors and in the corticotrophs of non-tumorous pituitaries. PMID: 25517869
  12. is the first correlation of oral squamous cell carcinoma with KLK10 rs3745535G>T polymorphisms PMID: 23413953
  13. KLK10 expression is an independent biomarker of unfavorable prognosis in patients with gastric cancer. PMID: 24409072
  14. Patients with high KLK10 expression had a shorter disease-free and overall survival rates. PMID: 23499583
  15. Enhancing KLK10 gene expression can decrease the proliferation and invasiveness of human tongue cancer cells in vitro. PMID: 23268413
  16. Finding lower KLK10 levels in pleomorphic adenoma suggests aberrant expression in a tumour that develops primarily from myoepithelial cells. A kallikrein cascade may play a role in the development and/or outcome of some salivary gland tumours. PMID: 23250777
  17. KLK10 DNA methylation was significantly associated with prostate cancer. PMID: 22874102
  18. Data indicate a statistically significant positive association between kallikrein-related peptidase 10 (KLK10) and tumor stage and liver metastases. PMID: 22437349
  19. Loss of KLK10 is associated with ovarian cancer. PMID: 22102857
  20. KLK10 gene expression may be used as a marker of unfavorable prognosis for colorectal cancer PMID: 21487810
  21. Single nucleotide polymorphisms in KLK10 is not associated with ovarian cancer. PMID: 20686372
  22. Results indicate that cells underwent EMT exhibited overactive TGFbeta signaling and loss of expression of the CDH1, CGN, CLDN4, and KLK10 genes as a result of hypermethylation of their corresponding promoter regions. PMID: 20086175
  23. NES1/kallikrein 10 mRNA is expressed in normal breast tissue and benign lesions, with loss of NES1/kallikrein 10 expression during tumor progression. PMID: 11705853
  24. Identification of single nucleotide polymorphisms in the human kallikrein 10 (KLK10) gene and their association with prostate, breast, testicular, and ovarian cancers. PMID: 11920956
  25. Higher expression in breast cancer predicts tamoxifen resistance PMID: 12087468
  26. kallikrein 10 is expressed in the nonmalignant and malignant prostate, with cancer tissues demonstrating slightly lower expression PMID: 12970725
  27. Downregulation of kallikrein 10 is associated with breast cancer PMID: 14696124
  28. Kallikrein K10 is decreased in cerebrospinal fluid (CSF) of frontotemporal dementia patients and K10 is increased in CSF of Alzheimer patients, compared to control subjects. PMID: 14972646
  29. new splice variants of the KLK10 gene identified; in silico analyses show differential expression of gene in various malignancies and provide basis for directing experimental efforts to investigate possible role of gene as cancer biomarker PMID: 16103744
  30. CpG island hypermethylation plays an important role in the downregulation of kallikrein 10 mRNA and protein expression PMID: 16254462
  31. Kallikrein 10 is highly expressed in uterine serous papillary carcinoma, and it is released in the plasma and serum of uterine serous papillary carcinoma patients. PMID: 16647913
  32. REVIEW of KLK10 gene expression in neoplasm cells PMID: 16800732
  33. functional importance of retinoic acid response elements in the hK10 promoter was demonstrated by retinoid induction of hk10 promoter-reporters PMID: 16800735
  34. results suggest a co-regulation of KLK10 and KLK11 expression in lung and a lack of KLK10 suppressor role in non-small-cell lung cancer PMID: 16800740
  35. KLK10 expression is up-regulated in CRC and GC and higher expression of KLK10 closely correlates with advanced disease stage, which predicts a poorer prognosis. PMID: 16928223
  36. Results suggest that NES1 inactivation might contribute to the malignant progression of human gastric cancers. PMID: 17182177
  37. Glucocorticoid receptor-mediated expression of kallikrein 10 PMID: 17937626
  38. The hormone-specific upregulation of PSA, KLK10 and KLK11 in the breast cancer cell line T47D is dependent on major intracellular signaling pathways. PMID: 18515984
  39. Suppression of gastric cancer growth by baculovirus vector-mediated transfer of normal epithelial cell specific-1 gene. PMID: 18855978
  40. synergistic effects between estrogens and androgens on estrogen-sensitive genes may have implications on the role of the kallikreins 10, 11, and 14 in associated risk of breast cancer and progression. PMID: 19383315
  41. Down-Regulation of KLK10 through DNA Methylation is associated with hepatocellular carcinoma. PMID: 19760608

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
Peptidase S1 family, Kallikrein subfamily
Tissue Specificity
Expressed in breast, ovary and prostate.
Database Links

HGNC: 6358

OMIM: 602673

KEGG: hsa:5655

STRING: 9606.ENSP00000311746

UniGene: Hs.275464

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*