Recombinant Human Killer cell lectin-like receptor subfamily G member 1 (KLRG1), partial

In Stock
Code CSB-EP846610HU
Abbreviation Recombinant Human KLRG1 protein, partial
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Immunology
Alternative Names
2F1 Ag; 2F1; C type lectin domain family 15 member A; C-type lectin domain family 15 member A; CLEC15A; ITIM containing receptor MAFA L; ITIM-containing receptor MAFA-L; Killer cell lectin like receptor G1 ; Killer cell lectin like receptor subfamily G member 1; Killer cell lectin-like receptor subfamily G member 1; KLRG 1; KLRG1; KLRG1 protein; KLRG1_HUMAN; MAFA 2F1; MAFA; MAFA L; MAFA like; MAFA like receptor; MAFA-like receptor; MAFAL; Mast cell function associated antigen (ITIM containing); Mast cell function associated antigen; Mast cell function-associated antigen 2F1; Mast cell function-associated antigen; Mast cell function-associated antigen, rat, homolog of; MGC13600
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
60-195aa
Target Protein Sequence
LCQGSNYSTCASCPSCPDRWMKYGNHCYYFSVEEKDWNSSLEFCLARDSHLLVITDNQEMSLLQVFLSEAFCWIGLRNNSGWRWEDGSPLNFSRISSNSFVQTCGAINKNGLQASSCEVPLHWVCKKCPFADQALF
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
31.5kDa
Protein Length
Extracellular Domain
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Plays an inhibitory role on natural killer (NK) cells and T-cell functions upon binding to their non-MHC ligands. May mediate missing self recognition by binding to a highly conserved site on classical cadherins, enabling it to monitor expression of E-cadherin/CDH1, N-cadherin/CDH2 and R-cadherin/CDH4 on target cells.
Gene References into Functions
  1. KLRG1 might contribute to the impaired antitumor immunity of memory T cells in tumor microenvironment PMID: 27557510
  2. Killer Cell Lectin-like Receptor G1 Inhibits NK Cell Function through Activation of Adenosine 5'-Monophosphate-Activated Protein Kinase PMID: 27566818
  3. The results suggest that a disease-associated SNP located within the 3'UTR of KLRG1 directly interferes with miR-584-5p binding, allowing for KLRG1 mRNA differential accumulation, which in turn may contribute to pathogenesis of pemphigus. PMID: 27424220
  4. Demonstrate the presence of increased KLRG1-expressing T-cells in tuberculosis-treated individuals, and present KLRG1 as a marker of decreased human T-cell proliferation following BCG-vaccination. PMID: 26750180
  5. This finding provides a rationale for the reciprocal expression of KLRG1 and CD103 in different CD8(+) T-cell subsets. PMID: 26014037
  6. high levels of TfRs such as those found on activated lymphocytes were found to be associated with decreased KLRG1 inhibitory function, indicating that TfRs may sequester KLRG1 from interacting with cadherins. PMID: 24752778
  7. More T cells were KLRG1+ in the synovial fluid of patients with spondylarthritis/rheumatoid arthritis than crystal arthritis or controls. Those T cells were more functionally active, and migrated towards the synovial fluid of SpA/RA patients. PMID: 23740233
  8. KLRG1 was overexpressed on CD4(+) T cells. PMID: 24337749
  9. Data indicate that increments of CD8 + effector memory T cells in human and mouse chronic lymphocytic leukemia (CLL)(Emu-TCL1 model) were due to an expansion of the inhibitory killer cell lectin-like receptor G1 (KLRG1) expressing cellular subset. PMID: 24022692
  10. These results indicate that KLRG1 negatively regulates natural killer cell numbers and functions via the Akt pathway, thus providing a novel marker and therapeutic target for hepatitis C virus infection. PMID: 23966413
  11. The lower inhibitory capacity of mKLRG1 compared with hKLRG1 can thus be rationalized by a decreased proportion of dimeric entities, which can be pinpointed to a single amino acid. PMID: 22684915
  12. cytomegalovirus positive had lower proportions of NK-cells expressing inhibitory receptors (KLRG1 and CD158a) PMID: 21933704
  13. trastuzumab-mediated antibody-dependent cellular cytotoxicity was markedly enhanced by KLRG1-negative peripheral blood mononuclear cells PMID: 21387286
  14. Results demonstrated a substantial reduction in both CD94- and KLRG1- expressing CD3(-)CD56(+) NK cells with increased age. PMID: 20394788
  15. Expression of MafA analyzed in conditional knockout mice during embryonic development is the first specific marker of a subpopulation of "early c-ret" positive sensory neurons. PMID: 20213756
  16. human effector and memory T cells expressing KLRG1 lack proliferative capacity PMID: 12393723
  17. KLRG1 expression discriminated between cord blood T cells that differed in their post-thymic expansion rate PMID: 15368283
  18. KLRG1 is expressed in the overwhelming majority of CD8-positive T cells specific for epitopes of cytomegalovirus or Epstein- Barr virus during the latent stage; a slightly lower KLRG1 expression level is observed in HIV-specific T8 cells. PMID: 15879103
  19. virus-specific CD8+ T cells are mostly KLRG1+ in chronic viral infections (human immunodeficiency virus, cytomegalovirus, and Epstein-Barr virus) but not in resolved infection (influenza virus) PMID: 16140789
  20. peripheral HCV-specific CD8+ T cells were CD127+ and KLRG1-; Intrahepatic virus-specific CD8+ T cells displayed significantly reduced levels of CD127 expression but similar levels of KLRG1 expression compared to the peripheral blood. PMID: 17079288
  21. study demonstrates that E-cadherin represents a ligand for KLRG1 and that ligation of KLRG1 by E-cadherin inhibited effector cell functions of polyclonal NK cells PMID: 17617594
  22. Certain aspects of the dysfunction seen in highly differentiated CD8+ T cells are maintained actively by KLRG1 signaling. KLRG1 blockade enhances Akt (ser(473)) phosphorylation & T-cell-receptor-induced proliferation of CD8+CD28-CD27- T cells. PMID: 19406987
  23. E-cadherin may coengage KLRG1 and alpha(E)beta(7) and that KLRG1 overcomes its exceptionally weak affinity for cadherins through multipoint attachment to target cells, resulting in inhibitory signaling. PMID: 19604491

Show More

Hide All

Subcellular Location
Cell membrane; Single-pass type II membrane protein.
Tissue Specificity
Expressed specifically on natural killer (NK) cells and T-cells, mainly CD8 T-cells.
Database Links

HGNC: 6380

OMIM: 604874

KEGG: hsa:10219

STRING: 9606.ENSP00000349477

UniGene: Hs.558446

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*