Purity
Greater than 90% as determined by SDS-PAGE.
Alternative Names
2F1 Ag; 2F1; C type lectin domain family 15 member A; C-type lectin domain family 15 member A; CLEC15A; ITIM containing receptor MAFA L; ITIM-containing receptor MAFA-L; Killer cell lectin like receptor G1 ; Killer cell lectin like receptor subfamily G member 1; Killer cell lectin-like receptor subfamily G member 1; KLRG 1; KLRG1; KLRG1 protein; KLRG1_HUMAN; MAFA 2F1; MAFA; MAFA L; MAFA like; MAFA like receptor; MAFA-like receptor; MAFAL; Mast cell function associated antigen (ITIM containing); Mast cell function associated antigen; Mast cell function-associated antigen 2F1; Mast cell function-associated antigen; Mast cell function-associated antigen, rat, homolog of; MGC13600
Species
Homo sapiens (Human)
Expression Region
60-195aa
Target Protein Sequence
LCQGSNYSTCASCPSCPDRWMKYGNHCYYFSVEEKDWNSSLEFCLARDSHLLVITDNQEMSLLQVFLSEAFCWIGLRNNSGWRWEDGSPLNFSRISSNSFVQTCGAINKNGLQASSCEVPLHWVCKKCPFADQALF
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Extracellular Domain
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
