Purity
Greater than 85% as determined by SDS-PAGE.
Research Area
Cardiovascular
Alternative Names
40 kDa erythrocyte membrane protein; G protein-coupled receptor 69A; GPR69A; LanC (bacterial lantibiotic synthetase component C) like 1; LanC lantibiotic synthetase component C like 1 (bacterial); LanC-like protein 1; LANC1_HUMAN; LANCL1; p40
Species
Homo sapiens (Human)
Expression Region
2-399aa
Target Protein Sequence
AQRAFPNPYADYNKSLAEGYFDAAGRLTPEFSQRLTNKIRELLQQMERGLKSADPRDGTGYTGWAGIAVLYLHLYDVFGDPAYLQLAHGYVKQSLNCLTKRSITFLCGDAGPLAVAAVLYHKMNNEKQAEDCITRLIHLNKIDPHAPNEMLYGRIGYIYALLFVNKNFGVEKIPQSHIQQICETILTSGENLARKRNFTAKSPLMYEWYQEYYVGAAHGLAGIYYYLMQPSLQVSQGKLHSLVKPSVDYVCQLKFPSGNYPPCIGDNRDLLVHWCHGAPGVIYMLIQAYKVFREEKYLCDAYQCADVIWQYGLLKKGYGLCHGSAGNAYAFLTLYNLTQDMKYLYRACKFAEWCLEYGEHGCRTPDTPFSLFEGMAGTIYFLADLLVPTKARFPAFEL
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer，50% glycerol
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
Inserting the gene encoding the Human LANCL1 protein (2-399aa) into a plasmid vector results in the creation of recombinant plasmid, which is introduced into e.coli cells. e.coli cells that can survive in the presence of a specific antibiotic are selected, indicating successful uptake of the recombinant plasmid. The e.coli cells containing the recombinant plasmid are cultured under conditions promoting the expression of the gene of interest. A N-terminal 10xHis tag and C-terminal Myc tag is linked to the protein. After expression, affinity purification is used to isolate and purify the recombinant Human LANCL1 protein from the cell lysate. Denaturing SDS-PAGE is then applied to resolve the resulting recombinant Human LANCL1 protein, revealing a purity level exceeding 85%.
