Recombinant Human Leukocyte antigen CD37 (CD37), partial

Code CSB-YP004928HU1
MSDS
Size Pls inquire
Source Yeast
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP004928HU1
MSDS
Size Pls inquire
Source E.coli
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP004928HU1-B
MSDS
Size Pls inquire
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-BP004928HU1
MSDS
Size Pls inquire
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-MP004928HU1
MSDS
Size Pls inquire
Source Mammalian cell
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
>85% (SDS-PAGE)
Target Names
Uniprot No.
Alternative Names
CD37; TSPAN26; Leukocyte antigen CD37; Tetraspanin-26; Tspan-26; CD antigen CD37
Species
Homo sapiens (Human)
Protein Length
Partial
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

 Q&A
Q:

Regarding your protein CSB-MP004928HU1, could you please provde some informations?
Also, could you please confirm what the mammalian cell host is that would be used to create the mammalian cell-expressed protein? What all mammalian cells are available?

A:
Very nice to receive your inquiry. Since this is a transmembrane protein, we can provide the full length protein expressed by the cell free expression system, and provide the partial protein expressed by the regular four expression systems:
Recombinant Human Leukocyte antigen CD37(CD37)
CSB-CF004928HU
Expression Region: 1-281aa; Full length.
Tag information:Tag type will be determined during the manufacturing process. (The expected tag is N-terminal 10xHis-tagged)
Sequence:

MSAQESCLSLIKYFLFVFNLFFFVLGSLIFCFGIWILIDKTSFVSFVGLAFVPLQIWSKVLAISGIFTMGIALLGCVGALKELRCLLGLYFGMLLLLFATQITLGILISTQRAQLERSLRDVVEKTIQKYGTNPEETAAEESWDYVQFQLRCCGWHYPQDWFQVLILRGNGSEAHRVPCSCYNLSATNDSTILDKVILPQLSRLGHLARSRHSADICAVPAESHIYREGCAQGLQKWLHNNLISIVGICLGVGLLELGFMTLSIFLCRNLDHVYNRLARYR


Recombinant Human Leukocyte antigen CD37(CD37),partial
CSB-YP004928HU1 >> Yeast
CSB-EP004928HU1 >> E.coli
CSB-BP004928HU1 >> Baculovirus
CSB-MP004928HU1 >> Mammalian cell
Expression Region: 112-241aa; Partial.
Tag information:EP, YP, BP, MP: Tag type will be determined during the manufacturing process.
The expected tag for each expression system is listed as follows:
YP: N-terminal 6xHis-tagged; EP, BP, MP: N-terminal 10xHis-tagged and C-terminal Myc-tagged.
Sequence:

RAQLERSLRDVVEKTIQKYGTNPEETAAEESWDYVQFQLRCCGWHYPQDWFQVLILRGNGSEAHRVPCSCYNLSATNDSTILDKVILPQLSRLGHLARSRHSADICAVPAESHIYREGCAQGLQKWLHNN


Generally, the mammalian cell used to produce the protein is HEK 293, becasue compared with the CHO cells, HEK293 cells grow faster and are easier to transfect, foreign protein expression yield is high.
However, the CHO cell is also available if you have this request. For the time being, all mammalian cells available are CHO cell and HEK293 cells.

Target Background

Gene References into Functions
  1. CD37 is a critical determinant of rituximab plus cyclophosphamide, doxorubicin, vincristine, and prednisone outcome in diffuse large B-cell lymphoma. PMID: 27760757
  2. Data indicate that cell differentiation antigen 37 (CD37) is well expressed and a potential drug target in acute myeloid leukemia (AML). PMID: 25934707
  3. The CD37-targeted antibody-drug conjugate IMGN529 is highly active against human CLL and in a novel CD37 transgenic murine leukemia model. PMID: 24445867
  4. Data indicate that enhanced antibody-dependent cell cytotoxicity (ADCC) is observed against chronic lymphocytic leukemia cells and is sustained at concentrations of SMIP-016(GV) as low at 5E(-6) microg/mL on cells expressing minimal CD37 antigen. PMID: 23883821
  5. Identify two tyrosine residues in tetraspanin CD37 directly mediating transduction of survival and apoptotic signals. PMID: 22624718
  6. In the absence of both CD37 and Tssc6, immune function is further altered when compared with CD37- or Tssc6-deficient transgenic mice, demonstrating a complementary role for these two molecules in cellular immunity. PMID: 20709950
  7. CD37 cross-linking on human T cells transduces signals that lead to complete inhibition of CD3-induced T cell proliferation. PMID: 14978098
  8. CD37 is important for dectin-1 stabilization in APC membranes and controls dectin-1-mediated IL-6 production. PMID: 17182550
  9. provide strong justification for CD37 as a therapeutic target and introduce small modular immunopharmaceuticals as a novel class of targeted therapies for B-cell malignancies PMID: 17440052

Show More

Hide All

Subcellular Location
Membrane; Multi-pass membrane protein.
Protein Families
Tetraspanin (TM4SF) family
Tissue Specificity
B-lymphocytes.
Database Links

HGNC: 1666

OMIM: 151523

KEGG: hsa:951

STRING: 9606.ENSP00000325708

UniGene: Hs.166556

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1