Recombinant Human Leukocyte antigen CD37 (CD37)

In Stock
Code CSB-CF004928HU
Abbreviation Recombinant Human CD37 protein
MSDS
Size $1040
Order now
Image
  • Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
CD37; TSPAN26; Leukocyte antigen CD37; Tetraspanin-26; Tspan-26; CD antigen CD37
Species
Homo sapiens (Human)
Source
in vitro E.coli expression system
Expression Region
1-281
Target Protein Sequence
MSAQESCLSLIKYFLFVFNLFFFVLGSLIFCFGIWILIDKTSFVSFVGLAFVPLQIWSKV LAISGIFTMGIALLGCVGALKELRCLLGLYFGMLLLLFATQITLGILISTQRAQLERSLR DVVEKTIQKYGTNPEETAAEESWDYVQFQLRCCGWHYPQDWFQVLILRGNGSEAHRVPCS CYNLSATNDSTILDKVILPQLSRLGHLARSRHSADICAVPAESHIYREGCAQGLQKWLHN NLISIVGICLGVGLLELGFMTLSIFLCRNLDHVYNRLARYR
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full length protein
Tag Info
N-terminal 10xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from Tris/PBS-based buffer, 6% Trehalose
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

This Recombinant Human CD37 (TSPAN26) protein is a key player in the realm of immunology research. CD37, also known as leukocyte antigen CD37, Tetraspanin-26 (Tspan-26), is an essential component involved in various immune processes. This recombinant protein is synthesized using an advanced in vitro E.coli expression system, ensuring its high quality and functionality. It encompasses the full length of the CD37 protein, spanning amino acids 1 to 281, providing a comprehensive understanding of its biological activities and interactions.

To facilitate easy detection and purification, the Recombinant Human CD37 features an N-terminal 10xHis tag. This tag enhances its solubility and simplifies downstream applications. With a purity level of greater than 85% as determined by SDS-PAGE, you can trust in the reliability and consistency of this protein for your research. Whether you prefer liquid or lyophilized powder form, we offer both options, providing flexibility in storage and experimental setups. Explore the vast potential of the Recombinant Human CD37 protein in advancing your immunological investigations and gaining deeper insights into immune responses and cell signaling pathways.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Gene References into Functions
  1. CD37 is a critical determinant of rituximab plus cyclophosphamide, doxorubicin, vincristine, and prednisone outcome in diffuse large B-cell lymphoma. PMID: 27760757
  2. Data indicate that cell differentiation antigen 37 (CD37) is well expressed and a potential drug target in acute myeloid leukemia (AML). PMID: 25934707
  3. The CD37-targeted antibody-drug conjugate IMGN529 is highly active against human CLL and in a novel CD37 transgenic murine leukemia model. PMID: 24445867
  4. Data indicate that enhanced antibody-dependent cell cytotoxicity (ADCC) is observed against chronic lymphocytic leukemia cells and is sustained at concentrations of SMIP-016(GV) as low at 5E(-6) microg/mL on cells expressing minimal CD37 antigen. PMID: 23883821
  5. Identify two tyrosine residues in tetraspanin CD37 directly mediating transduction of survival and apoptotic signals. PMID: 22624718
  6. In the absence of both CD37 and Tssc6, immune function is further altered when compared with CD37- or Tssc6-deficient transgenic mice, demonstrating a complementary role for these two molecules in cellular immunity. PMID: 20709950
  7. CD37 cross-linking on human T cells transduces signals that lead to complete inhibition of CD3-induced T cell proliferation. PMID: 14978098
  8. CD37 is important for dectin-1 stabilization in APC membranes and controls dectin-1-mediated IL-6 production. PMID: 17182550
  9. provide strong justification for CD37 as a therapeutic target and introduce small modular immunopharmaceuticals as a novel class of targeted therapies for B-cell malignancies PMID: 17440052

Show More

Hide All

Subcellular Location
Membrane; Multi-pass membrane protein.
Protein Families
Tetraspanin (TM4SF) family
Tissue Specificity
B-lymphocytes.
Database Links

HGNC: 1666

OMIM: 151523

KEGG: hsa:951

STRING: 9606.ENSP00000325708

UniGene: Hs.166556

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*