Product Details

Target Names

CD37

Uniprot No.

P11049

Alternative Names

CD37; TSPAN26; Leukocyte antigen CD37; Tetraspanin-26; Tspan-26; CD antigen CD37

Species

Homo sapiens (Human)

Source

in vitro E.coli expression system

Expression Region

1-281

Target Protein Sequence

MSAQESCLSLIKYFLFVFNLFFFVLGSLIFCFGIWILIDKTSFVSFVGLAFVPLQIWSKV LAISGIFTMGIALLGCVGALKELRCLLGLYFGMLLLLFATQITLGILISTQRAQLERSLR DVVEKTIQKYGTNPEETAAEESWDYVQFQLRCCGWHYPQDWFQVLILRGNGSEAHRVPCS CYNLSATNDSTILDKVILPQLSRLGHLARSRHSADICAVPAESHIYREGCAQGLQKWLHN NLISIVGICLGVGLLELGFMTLSIFLCRNLDHVYNRLARYR
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.

Protein Length

Full length protein

Tag Info

N-terminal 10xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

This Recombinant Human CD37 (TSPAN26) protein is a key player in the realm of immunology research. CD37, also known as leukocyte antigen CD37, Tetraspanin-26 (Tspan-26), is an essential component involved in various immune processes. This recombinant protein is synthesized using an advanced in vitro E.coli expression system, ensuring its high quality and functionality. It encompasses the full length of the CD37 protein, spanning amino acids 1 to 281, providing a comprehensive understanding of its biological activities and interactions.

To facilitate easy detection and purification, the Recombinant Human CD37 features an N-terminal 10xHis tag. This tag enhances its solubility and simplifies downstream applications. With a purity level of greater than 85% as determined by SDS-PAGE, you can trust in the reliability and consistency of this protein for your research. Whether you prefer liquid or lyophilized powder form, we offer both options, providing flexibility in storage and experimental setups. Explore the vast potential of the Recombinant Human CD37 protein in advancing your immunological investigations and gaining deeper insights into immune responses and cell signaling pathways.

Target Background

Gene References into Functions

CD37 is a critical determinant of rituximab plus cyclophosphamide, doxorubicin, vincristine, and prednisone outcome in diffuse large B-cell lymphoma. PMID: 27760757
Data indicate that cell differentiation antigen 37 (CD37) is well expressed and a potential drug target in acute myeloid leukemia (AML). PMID: 25934707
The CD37-targeted antibody-drug conjugate IMGN529 is highly active against human CLL and in a novel CD37 transgenic murine leukemia model. PMID: 24445867
Data indicate that enhanced antibody-dependent cell cytotoxicity (ADCC) is observed against chronic lymphocytic leukemia cells and is sustained at concentrations of SMIP-016(GV) as low at 5E(-6) microg/mL on cells expressing minimal CD37 antigen. PMID: 23883821
Identify two tyrosine residues in tetraspanin CD37 directly mediating transduction of survival and apoptotic signals. PMID: 22624718
In the absence of both CD37 and Tssc6, immune function is further altered when compared with CD37- or Tssc6-deficient transgenic mice, demonstrating a complementary role for these two molecules in cellular immunity. PMID: 20709950
CD37 cross-linking on human T cells transduces signals that lead to complete inhibition of CD3-induced T cell proliferation. PMID: 14978098
CD37 is important for dectin-1 stabilization in APC membranes and controls dectin-1-mediated IL-6 production. PMID: 17182550
provide strong justification for CD37 as a therapeutic target and introduce small modular immunopharmaceuticals as a novel class of targeted therapies for B-cell malignancies PMID: 17440052

Hide All

Subcellular Location

Membrane; Multi-pass membrane protein.

Protein Families

Tetraspanin (TM4SF) family

Tissue Specificity

B-lymphocytes.

Database Links

HGNC: 1666

OMIM: 151523

KEGG: hsa:951

STRING: 9606.ENSP00000325708

UniGene: Hs.166556

Place an order now

I. Product details

Product name *

Code *

Size *

Quantity *

Message

II. Contact details

Name *

Email address *

Company/Organization

Phone

III. Ship To

Address *

City *

State/Province *

Zip/Post code *

Country *

Attn Name *

Phone# *

IV. Bill To Same as Shipping Address

Address *

City *

State/Province *

Zip/Post code *

Country *

Attn Name *

Phone# *

CAPTCHA verification *

Code	CSB-CF004928HU
MSDS	MSDS
Size	$1040
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Leukocyte antigen CD37 (CD37)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage