Recombinant Human Leukocyte immunoglobulin-like receptor subfamily A member 5(LILRA5),partial

Code CSB-YP012937HU
Product Type Recombinant Protein
Size US$2010
Uniprot No. A6NI73
Relevance May play a role in triggering innate immune responses. Does not se to play a role for any class I MHC antigen recognition.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias CD85 antigen-like family member FImmunoglobulin-like transcript 11 ;ILT-11Leukocyte immunoglobulin-like receptor 9 ;LIR-9; CD85f
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence GNLSKATLWAEPGSVISRGNSVTIRCQGTLEAQEYRLVKEGSPEPWDTQNPLEPKNKARFSIPSMTEHHAGRYRCYYYSPAGWSEPSDPLELVVTGFYNKPTLSALPSPVVTSGENVTLQCGSRLRFDRFILTEEGDHKLSWTLDSQLTPSGQFQALFPVGPVTPSHRWMLRCYGSRRHILQVWSEPSDLLEIPVSGAADNLSPSQNKSDSGTASHLQDYAVENLIR
Research Area Immunology
Source Yeast
Gene Names LILRA5
Protein Names Recommended name: Leukocyte immunoglobulin-like receptor subfamily A member 5 Alternative name(s): CD85 antigen-like family member F Immunoglobulin-like transcript 11 Short name= ILT-11 Leukocyte immunoglobulin-like receptor 9 S
Expression Region 42-268aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 27.2kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function May play a role in triggering innate immune responses. Does not seem to play a role for any class I MHC antigen recognition.
Subcellular Location Cell membrane, Single-pass type I membrane protein, SUBCELLULAR LOCATION: Isoform 3: Secreted
Tissue Specificity Expressed mostly in tissues of the hematopoietic system, including bone marrow, spleen, lymph node and peripheral leukocytes. Among leukocytes, monocytes and neutrophils express the highest level. Expressed in CD14+ monocytes, but not in T-cells, B-cells
Database Links

HGNC: 16309

OMIM: 606047

KEGG: hsa:353514

STRING: 9606.ENSP00000301219

UniGene: Hs.710986

Pathway Osteoclast differentiation

Related Products

LILRA5 Antibodies

LILRA5 Antibodies for Homo sapiens (Human)

LILRA5 ELISA Kit

LILRA5 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.