Code | CSB-EP619076HU |
Size | $1812 How to order? |
Image | |
Have Questions? | Leave a Message or Start an on-line Chat |
Description |
Recombinant Human Lymphocyte antigen 6E (LY6E) with an N-terminal 6xHis-SUMO-tag is a full-length of mature protein expressed in E.coli. The sequence used to prepare this recombinant LY6E protein corresponds to residues Leu21-Ser101 of Human LY6E. Its purity is greater than 90% determined by SDS-PAGE. A molecular mass band of approximately 24 kDa was visualized on the gel. And in-stock LY6E proteins are offered now. This recombinant LY6E protein may be used to produce specific anti-LY6E antibodies or in the studies of cell biology. LY6E, also called SCA2 or TSA1, is a member of the LY6/uPAR family of glycosylphosphatidylinositol-anchored proteins. It exerts roles in multiple cellular processes, such as T-cell differentiation, the regulation of the T-cell receptor signaling pathway of activated T cells, and the self-renewal of erythroid progenitors. Stephanie Pfaender etc. recently demonstrated that LY6E is a key antiviral immune effector that controls coronavirus (CoV) infection and pathogenesis through the inhibition of CoV entry into cells by interfering with spike protein-mediated membrane fusion. And LY6E is overexpressed in diverse human malignant cells. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Target Names | LY6E |
Uniprot No. | Q16553 |
Research Area | Cell Biology |
Alternative Names | LY6E; 9804; RIGE; SCA2; TSA1; Lymphocyte antigen 6E; Ly-6E; Retinoic acid-induced gene E protein; RIG-E; Stem cell antigen 2; SCA-2; Thymic shared antigen 1; TSA-1 |
Species | Homo sapiens (Human) |
Source | E.coli |
Expression Region | 21-101aa |
Target Protein Sequence | LMCFSCLNQKSNLYCLKPTICSDQDNYCVTVSASAGIGNLVTFGHSLSKTCSPACPIPEGVNVGVASMGISCCQSFLCNFS Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request. |
Mol. Weight | 24.5kDa |
Protein Length | Full Length of Mature Protein |
Tag Info |
N-terminal 6xHis-SUMO-tagged |
Form |
Liquid or Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand. |
Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Troubleshooting and FAQs |
Protein FAQs |
Storage Condition | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Lead Time | 3-7 business days |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Datasheet & COA | Please contact us to get it. |
There are currently no reviews for this product.
I recently purchased this protein. And I would like to know:
1.Can you clarify if there is a His6 vs His10 tag?
2.Can you provide the sequence of the SUMO tag and clarify if it was cleaved post purification?
Function |
GPI-anchored cell surface protein that regulates T-lymphocytes proliferation, differentiation, and activation. Regulates the T-cell receptor (TCR) signaling by interacting with component CD3Z/CD247 at the plasma membrane, leading to CD3Z/CD247 phosphorylation modulation. Restricts the entry of human coronaviruses, including SARS-CoV, MERS-CoV and SARS-CoV-2, by interfering with spike protein-mediated membrane fusion. Plays also an essential role in placenta formation by acting as the main receptor for syncytin-A (SynA). Therefore, participates in the normal fusion of syncytiotrophoblast layer I (SynT-I) and in the proper morphogenesis of both fetal and maternal vasculatures within the placenta. May also act as a modulator of nicotinic acetylcholine receptors (nAChRs) activity.; (Microbial infection) Promotes entry, likely through an enhanced virus-cell fusion process, of various viruses including HIV-1, West Nile virus, dengue virus and Zika virus. In contrast, the paramyxovirus PIV5, which enters at the plasma membrane, does not require LY6E. Mechanistically, adopts a microtubule-like organization upon viral infection and enhances viral uncoating after endosomal escape.
|
Gene References into Functions |
|
Subcellular Location | Cell membrane; Lipid-anchor, GPI-anchor. |
Tissue Specificity | Widely expressed, predominantly in liver, kidney, ovary, spleen and peripheral blood Leukocytes. |
Database Links |
HGNC: 6727 OMIM: 601384 KEGG: hsa:4061 STRING: 9606.ENSP00000292494 UniGene: Hs.521903 |