Recombinant Human Lymphocyte antigen 6E (LY6E)

In Stock
Code CSB-EP619076HU
Abbreviation Recombinant Human LY6E protein
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Cell Biology
Alternative Names
LY6E; 9804; RIGE; SCA2; TSA1; Lymphocyte antigen 6E; Ly-6E; Retinoic acid-induced gene E protein; RIG-E; Stem cell antigen 2; SCA-2; Thymic shared antigen 1; TSA-1
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
21-101aa
Target Protein Sequence
LMCFSCLNQKSNLYCLKPTICSDQDNYCVTVSASAGIGNLVTFGHSLSKTCSPACPIPEGVNVGVASMGISCCQSFLCNFS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
24.5kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Human Lymphocyte antigen 6E (LY6E) with an N-terminal 6xHis-SUMO-tag is a full-length of mature protein expressed in E.coli. The sequence used to prepare this recombinant LY6E protein corresponds to residues Leu21-Ser101 of Human LY6E. Its purity is greater than 90% determined by SDS-PAGE. A molecular mass band of approximately 24 kDa was visualized on the gel. And in-stock LY6E proteins are offered now. This recombinant LY6E protein may be used to produce specific anti-LY6E antibodies or in the studies of cell biology.

LY6E, also called SCA2 or TSA1, is a member of the LY6/uPAR family of glycosylphosphatidylinositol-anchored proteins. It exerts roles in multiple cellular processes, such as T-cell differentiation, the regulation of the T-cell receptor signaling pathway of activated T cells, and the self-renewal of erythroid progenitors. Stephanie Pfaender etc. recently demonstrated that LY6E is a key antiviral immune effector that controls coronavirus (CoV) infection and pathogenesis through the inhibition of CoV entry into cells by interfering with spike protein-mediated membrane fusion. And LY6E is overexpressed in diverse human malignant cells.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

 Q&A
Q:

I recently purchased this protein. And I would like to know:
1.Can you clarify if there is a His6 vs His10 tag?
2.Can you provide the sequence of the SUMO tag and clarify if it was cleaved post purification?

A:
Thanks for your feedback.
1.SUMO enzyme (also known as ULP1 protease) can be used to remove the N-terminal 6xHis-SUMO-tag, however, the success rate for cleavage is not very high, only 50% (The sumo enzyme recognizes the sumo spatial structure.). Meanwhile, the protein loss will be relatively large after cleavage. So we don't suggest you to remove the tag yourselves.
2.If you would like no-tagged protein, we could re-design primers, adding other restriction sites for tag removal. The success rate will be higher than 85%.
If we succed in removing the tag, we will charge you for protein production cost + tag removal cost.
If we fail in removing the tag, we will send you the tagged protein and will only charge you for protein production cost.
3.If you are worried that the lead time for the above proposal is too long, we could also try to remove the tag from the previous lot of protein (Lot03613). However, the success rate will be only 50%.

Target Background

Function
GPI-anchored cell surface protein that regulates T-lymphocytes proliferation, differentiation, and activation. Regulates the T-cell receptor (TCR) signaling by interacting with component CD3Z/CD247 at the plasma membrane, leading to CD3Z/CD247 phosphorylation modulation. Restricts the entry of human coronaviruses, including SARS-CoV, MERS-CoV and SARS-CoV-2, by interfering with spike protein-mediated membrane fusion. Plays also an essential role in placenta formation by acting as the main receptor for syncytin-A (SynA). Therefore, participates in the normal fusion of syncytiotrophoblast layer I (SynT-I) and in the proper morphogenesis of both fetal and maternal vasculatures within the placenta. May also act as a modulator of nicotinic acetylcholine receptors (nAChRs) activity.; (Microbial infection) Promotes entry, likely through an enhanced virus-cell fusion process, of various viruses including HIV-1, West Nile virus, dengue virus and Zika virus. In contrast, the paramyxovirus PIV5, which enters at the plasma membrane, does not require LY6E. Mechanistically, adopts a microtubule-like organization upon viral infection and enhances viral uncoating after endosomal escape.
Gene References into Functions
  1. LY6E belongs to a growing class of interferon-inducible factors that broadly enhance viral infectivity in an interferon-independent manner. PMID: 30190477
  2. LY6E knockdown by targeted-siRNA inhibited gastric cancer cell survival and proliferation and induced G1-S cell cycle arrest and apoptosis in gastric cancer cells PMID: 29448250
  3. High LY6E expression is associated with breast cancer. PMID: 27589564
  4. LY6E overexpression is associated with Breast Cancer Progression, Immune Escape, and Drug Resistance. PMID: 27197181
  5. LY6E is a positive modulator of HIV-1 infection in primary human peripheral blood mononuclear cells, immortalized CD4+ T lymphoid cells, and macrophages. HIV Long Terminal Repeat-driven HIV-1 gene expression is also enhanced by LY6E, suggesting additional roles of LY6E in HIV-1 replication. PMID: 28130445
  6. LY6E level of gene expression may serve as good biomarkers for systemic lupus erythematosus diagnosis. PMID: 25344775
  7. the LY6E pathway in monocytes represents one of negative feedback mechanisms that counterbalance monocyte activation which may serve as a potential target for immune intervention. PMID: 25225669
  8. This study suggested that a mutation in SCA2 or SCA3/MJD may be one of the genetic causes of Parkinson's disease in china. PMID: 19672991
  9. Increased expression of the type I interferon-inducible gene, lymphocyte antigen 6 complex locus E, in peripheral blood cells is predictive of lupus activity in a large cohort of Chinese lupus patients. PMID: 18755862
  10. Two SCA3 and one SCA2 cases have been identified which show autosomal dominant inheritance in Parkinson disease. PMID: 18990604

Show More

Hide All

Subcellular Location
Cell membrane; Lipid-anchor, GPI-anchor.
Tissue Specificity
Widely expressed, predominantly in liver, kidney, ovary, spleen and peripheral blood Leukocytes.
Database Links

HGNC: 6727

OMIM: 601384

KEGG: hsa:4061

STRING: 9606.ENSP00000292494

UniGene: Hs.521903

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*