Recombinant Human Lymphocyte antigen 6E (LY6E) (Active)

In Stock
Code CSB-MP619076HU
Abbreviation Recombinant Human LY6E protein (Active)
MSDS
Size $256
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized Human LY6E protein at 2 μg/ml can bind Anti-LY6E recombinant antibody (CSB-RA619076MA1HU). The EC50 is 2.483-3.282 ng/mL. Biological Activity Assay
  • The purity of LY6E was greater than 95% as determined by SEC-HPLC
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Greater than 95% as determined by SEC-HPLC.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human LY6E protein at 2 μg/mL can bind Anti-LY6E recombinant antibody (CSB-RA619076MA1HU). The EC50 is 2.483-3.282 ng/mL.
Target Names
Uniprot No.
Alternative Names
Lymphocyte antigen 6E; Ly-6E;Retinoic acid-induced gene E protein (RIG-E); Stem cell antigen 2 (SCA-2); Thymic shared antigen 1 (TSA-1); LY6E; 9804, RIGE, SCA2, TSA1
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
21-101aa
Target Protein Sequence
LMCFSCLNQKSNLYCLKPTICSDQDNYCVTVSASAGIGNLVTFGHSLSKTCSPACPIPEGVNVGVASMGISCCQSFLCNFS
Mol. Weight
34.6 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal hFc-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
GPI-anchored cell surface protein that regulates T-lymphocytes proliferation, differentiation, and activation. Regulates the T-cell receptor (TCR) signaling by interacting with component CD3Z/CD247 at the plasma membrane, leading to CD3Z/CD247 phosphorylation modulation. Restricts the entry of human coronaviruses, including SARS-CoV, MERS-CoV and SARS-CoV-2, by interfering with spike protein-mediated membrane fusion. Plays also an essential role in placenta formation by acting as the main receptor for syncytin-A (SynA). Therefore, participates in the normal fusion of syncytiotrophoblast layer I (SynT-I) and in the proper morphogenesis of both fetal and maternal vasculatures within the placenta. May also act as a modulator of nicotinic acetylcholine receptors (nAChRs) activity.; (Microbial infection) Promotes entry, likely through an enhanced virus-cell fusion process, of various viruses including HIV-1, West Nile virus, dengue virus and Zika virus. In contrast, the paramyxovirus PIV5, which enters at the plasma membrane, does not require LY6E. Mechanistically, adopts a microtubule-like organization upon viral infection and enhances viral uncoating after endosomal escape.
Gene References into Functions
  1. LY6E belongs to a growing class of interferon-inducible factors that broadly enhance viral infectivity in an interferon-independent manner. PMID: 30190477
  2. LY6E knockdown by targeted-siRNA inhibited gastric cancer cell survival and proliferation and induced G1-S cell cycle arrest and apoptosis in gastric cancer cells PMID: 29448250
  3. High LY6E expression is associated with breast cancer. PMID: 27589564
  4. LY6E overexpression is associated with Breast Cancer Progression, Immune Escape, and Drug Resistance. PMID: 27197181
  5. LY6E is a positive modulator of HIV-1 infection in primary human peripheral blood mononuclear cells, immortalized CD4+ T lymphoid cells, and macrophages. HIV Long Terminal Repeat-driven HIV-1 gene expression is also enhanced by LY6E, suggesting additional roles of LY6E in HIV-1 replication. PMID: 28130445
  6. LY6E level of gene expression may serve as good biomarkers for systemic lupus erythematosus diagnosis. PMID: 25344775
  7. the LY6E pathway in monocytes represents one of negative feedback mechanisms that counterbalance monocyte activation which may serve as a potential target for immune intervention. PMID: 25225669
  8. This study suggested that a mutation in SCA2 or SCA3/MJD may be one of the genetic causes of Parkinson's disease in china. PMID: 19672991
  9. Increased expression of the type I interferon-inducible gene, lymphocyte antigen 6 complex locus E, in peripheral blood cells is predictive of lupus activity in a large cohort of Chinese lupus patients. PMID: 18755862
  10. Two SCA3 and one SCA2 cases have been identified which show autosomal dominant inheritance in Parkinson disease. PMID: 18990604

Show More

Hide All

Subcellular Location
Cell membrane; Lipid-anchor, GPI-anchor.
Tissue Specificity
Widely expressed, predominantly in liver, kidney, ovary, spleen and peripheral blood Leukocytes.
Database Links

HGNC: 6727

OMIM: 601384

KEGG: hsa:4061

STRING: 9606.ENSP00000292494

UniGene: Hs.521903

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*