Product Details

Purity

Greater than 95% as determined by SDS-PAGE.

Endotoxin

Less than 1.0 EU/ug as determined by LAL method.

Activity

Measured by its binding ability in a functional ELISA. Immobilized Human LY6E protein at 2 μg/mL can bind Anti-LY6E recombinant antibody (CSB-RA619076MA1HU). The EC50 is 2.483-3.282 ng/mL.

Target Names

LY6E

Uniprot No.

Q16553

Alternative Names

Lymphocyte antigen 6E; Ly-6E;Retinoic acid-induced gene E protein (RIG-E); Stem cell antigen 2 (SCA-2); Thymic shared antigen 1 (TSA-1); LY6E; 9804, RIGE, SCA2, TSA1

Species

Homo sapiens (Human)

Source

Mammalian cell

Expression Region

21-101aa

Target Protein Sequence

LMCFSCLNQKSNLYCLKPTICSDQDNYCVTVSASAGIGNLVTFGHSLSKTCSPACPIPEGVNVGVASMGISCCQSFLCNFS

Mol. Weight

34.6 kDa

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal hFc-tagged

Form

Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Target Background

Function

GPI-anchored cell surface protein that regulates T-lymphocytes proliferation, differentiation, and activation. Regulates the T-cell receptor (TCR) signaling by interacting with component CD3Z/CD247 at the plasma membrane, leading to CD3Z/CD247 phosphorylation modulation. Restricts the entry of human coronaviruses, including SARS-CoV, MERS-CoV and SARS-CoV-2, by interfering with spike protein-mediated membrane fusion. Plays also an essential role in placenta formation by acting as the main receptor for syncytin-A (SynA). Therefore, participates in the normal fusion of syncytiotrophoblast layer I (SynT-I) and in the proper morphogenesis of both fetal and maternal vasculatures within the placenta. May also act as a modulator of nicotinic acetylcholine receptors (nAChRs) activity.; (Microbial infection) Promotes entry, likely through an enhanced virus-cell fusion process, of various viruses including HIV-1, West Nile virus, dengue virus and Zika virus. In contrast, the paramyxovirus PIV5, which enters at the plasma membrane, does not require LY6E. Mechanistically, adopts a microtubule-like organization upon viral infection and enhances viral uncoating after endosomal escape.

Gene References into Functions

LY6E belongs to a growing class of interferon-inducible factors that broadly enhance viral infectivity in an interferon-independent manner. PMID: 30190477
LY6E knockdown by targeted-siRNA inhibited gastric cancer cell survival and proliferation and induced G1-S cell cycle arrest and apoptosis in gastric cancer cells PMID: 29448250
High LY6E expression is associated with breast cancer. PMID: 27589564
LY6E overexpression is associated with Breast Cancer Progression, Immune Escape, and Drug Resistance. PMID: 27197181
LY6E is a positive modulator of HIV-1 infection in primary human peripheral blood mononuclear cells, immortalized CD4+ T lymphoid cells, and macrophages. HIV Long Terminal Repeat-driven HIV-1 gene expression is also enhanced by LY6E, suggesting additional roles of LY6E in HIV-1 replication. PMID: 28130445
LY6E level of gene expression may serve as good biomarkers for systemic lupus erythematosus diagnosis. PMID: 25344775
the LY6E pathway in monocytes represents one of negative feedback mechanisms that counterbalance monocyte activation which may serve as a potential target for immune intervention. PMID: 25225669
This study suggested that a mutation in SCA2 or SCA3/MJD may be one of the genetic causes of Parkinson's disease in china. PMID: 19672991
Increased expression of the type I interferon-inducible gene, lymphocyte antigen 6 complex locus E, in peripheral blood cells is predictive of lupus activity in a large cohort of Chinese lupus patients. PMID: 18755862
Two SCA3 and one SCA2 cases have been identified which show autosomal dominant inheritance in Parkinson disease. PMID: 18990604

Hide All

Subcellular Location

Cell membrane; Lipid-anchor, GPI-anchor.

Tissue Specificity

Widely expressed, predominantly in liver, kidney, ovary, spleen and peripheral blood Leukocytes.

Database Links

HGNC: 6727

OMIM: 601384

KEGG: hsa:4061

STRING: 9606.ENSP00000292494

UniGene: Hs.521903

Message

Product >> Product Name：
Product >> Code：
Name： *
Email： *
Company/Organization：
Phone：
Since emails may get flagged by spam filters occasionally, we recommend leaving your phone number as a precaution. Your information is safe with us.
Question/Comment： *
Your Region： *
I'd like to receive email newsletters from Cusabio

Yes

No
How do you know CUSABIO?

Email

Distributor

Search engine

Advertisement

Others
CAPTCHA verification：
If CAPTCHA verification fails, click to refresh the CAPTCHA and try again.

Code	CSB-MP619076HU
Abbreviation	Recombinant Human LY6E protein (Active)
MSDS	MSDS Datasheet
Size	$256
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Activity Measured by its binding ability in a functional ELISA. Immobilized Human LY6E protein at 2 μg/ml can bind Anti-LY6E recombinant antibody (CSB-RA619076MA1HU). The EC₅₀ is 2.483-3.282 ng/mL. Biological Activity Assay
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Lymphocyte antigen 6E (LY6E) (Active)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage