Recombinant Human Matrix metalloproteinase-20(MMP20)

Code CSB-MP014667HU
Product Type Recombinant Protein
Size US$1848
Uniprot No. O60882
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Purity Greater than 85% as determined by SDS-PAGE.
Sequence YRLFPGEPKWKKNTLTYRISKYTPSMSSVEVDKAVEMALQAWSSAVPLSFVRINSGEADIMISFENGDHGDSYPFDGPRGTLAHAFAPGEGLGGDTHFDNAEKWTMGTNGFNLFTVAAHEFGHALGLAHSTDPSALMYPTYKYKNPYGFHLPKDDVKGIQALYGPRKVFLGKPTLPHAPHHKPSIPDLCDSSSSFDAVTMLGKELLLFKDRIFWRRQVHLRTGIRPSTITSSFPQLMSNVDAAYEVAERGTAYFFKGPHYWITRGFQMQGPPRTIYDFGFPRHVQQIDAAVYLREPQKTLFFVGDEYYSYDERKRKMEKDYPKNTEEEFSGVNGQIDAAVELNGYIYFFSGPKTYKYDTEKEDVVSVVKSSSWIGC
Research Area Others
Source Mammalian cell
Gene Names MMP20
Protein Names Recommended name: Matrix metalloproteinase-20 Short name= MMP-20 EC= 3.4.24.- Alternative name(s): Enamel metalloproteinase Enamelysin
Expression Region 108-483aa
Tag Info N-terminal 10xHis-tagged and C-terminal Myc-tagged
Mol. Weight 47.6
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Degrades amelogenin, the major protein component of the enamel matrix and two of the macromolecules characterizing the cartilage extracellular matrix
Involvement in disease Amelogenesis imperfecta, hypomaturation type, 2A2 (AI2A2)
Subcellular Location Secreted, extracellular space, extracellular matrix
Protein Families Peptidase M10A family
Tissue Specificity Expressed specifically in the enamel organ.
Database Links

HGNC: 7167

OMIM: 604629

KEGG: hsa:9313

STRING: 9606.ENSP00000260228

UniGene: Hs.591946

Related Products

MMP20 Antibodies

MMP20 Antibodies for Homo sapiens (Human)

MMP20 Proteins

MMP20 Proteins for Homo sapiens (Human)

MMP20 ELISA Kit

MMP20 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.