Product Details

Purity

Greater than 85% as determined by SDS-PAGE.

Target Names

MMP20

Uniprot No.

O60882

Research Area

Others

Alternative Names

AI2A2; Enamel metalloproteinase; Enamelysin; Matrix metalloproteinase 20; Matrix metalloproteinase-20; MMP 20; MMP-20; MMP20; MMP20_HUMAN

Species

Homo sapiens (Human)

Source

Baculovirus

Expression Region

108-483aa

Target Protein Sequence

YRLFPGEPKWKKNTLTYRISKYTPSMSSVEVDKAVEMALQAWSSAVPLSFVRINSGEADIMISFENGDHGDSYPFDGPRGTLAHAFAPGEGLGGDTHFDNAEKWTMGTNGFNLFTVAAHEFGHALGLAHSTDPSALMYPTYKYKNPYGFHLPKDDVKGIQALYGPRKVFLGKPTLPHAPHHKPSIPDLCDSSSSFDAVTMLGKELLLFKDRIFWRRQVHLRTGIRPSTITSSFPQLMSNVDAAYEVAERGTAYFFKGPHYWITRGFQMQGPPRTIYDFGFPRHVQQIDAAVYLREPQKTLFFVGDEYYSYDERKRKMEKDYPKNTEEEFSGVNGQIDAAVELNGYIYFFSGPKTYKYDTEKEDVVSVVKSSSWIGC
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

46.4

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

The plasmid vector incorporates the gene encoding the Human MMP20 protein (108-483aa), generating recombinant plasmid, which is then introduced into baculovirus cells. Selection of positive baculovirus cells is based on their capacity to withstand a particular antibiotic. Subsequently, the baculovirus cells containing the recombinant plasmid are cultivated under conditions that facilitate the expression of the Human MMP20 gene. The protein carries a N-terminal 10xHis tag and C-terminal Myc tag. Following expression, affinity purification is employed to isolate and purify the recombinant Human MMP20 protein from the cell lysate. Denaturing SDS-PAGE is used to resolve the resulting recombinant protein, enabling an estimation of its purity, exceeding 85%.

Target Background

Function

Degrades amelogenin, the major protein component of the enamel matrix and two of the macromolecules characterizing the cartilage extracellular matrix: aggrecan and the cartilage oligomeric matrix protein (COMP). May play a central role in tooth enamel formation. Cleaves aggrecan at the '360-Asn-|-Phe-361' site.

Gene References into Functions

The levels of MMP20 silencing-induced downregulation differed amongst CSC markers, with ABCG2 and CD44 showing more pronounced downregulations. PMID: 30002682
common variants at 11q22.2 within MMP20 associate with neuroblastoma cases harboring 11q deletion (rs10895322) PMID: 28924153
The article data showed that MMP20 rs1784418 C>T (Matrix metalloproteinase 20) appears to protect against dental caries, but its effects are likely to be more marked in certain populations. PMID: 27992873
DSPP-MMP20 pair may play a role in the normal turnover of cell surface proteins and/or repair of pericellular matrix proteins of the basement membranes in the metabolically active duct epithelial system of the nephrons. PMID: 27666430
Levels of matrix metalloproteinases MMP-19 and MMP-20 expression are significantly increased in pancreatic ductal adenocarcinoma (PDAC). PMID: 26692439
The expression of MMP20 was lower in calcifying cystic odontogenic tumor when compared to all tumors and cysts. PMID: 26558991
The growth of choroidal neovascularization in AMD would be affected by 2 genes: MMP20, a newly confirmed gene expressed in the retina, and ARMS2/HTRA1, a well-known susceptibility gene for AMD. PMID: 26337002
Novel homozygous mutation MMP20 (c.1054G>A, p.Glu352Lys) genes were identified in amelogenesis imperfect consanguinity. Mutant MMP20 was expressed at a normal level but secreted only minimally with proteolytic function. PMID: 26124219
expression of MMP-20 and co-expression and potential interaction with DSPP in human major salivary gland tissues PMID: 25805840
The results identify MMP-20 as a broad activator of pro-KLKs, suggesting the potential for intersection of the KLK and MMP axes under pathological dysregulation of MMP-20 expression. PMID: 23241590
Polymorphisms of MMP7 and MMP20 genes may be surrogate markers to predict long-term outcomes after kidney transplantation. PMID: 23953525
mineralized content slightly decreased; magnesium substituting for calcium in crystal. anomalies affected enamel with minimal interrod enamel; apatite crystals perpendicular to enamel prisms, suggesting possible new role for MMP20 in enamel formation. PMID: 23625376
amelogenesis imperfecta-causing mutations were identified in three of the probands: 2)a novel missense transition mutation in both MMP20 alleles (g.15390A>G; c.611A>G; p.His204Arg) that substituted arginine for histidine. PMID: 23355523
Variation in MMP20 may be associated with caries experience mainly in Caucasian subjects with poor oral health habits. PMID: 22330321
hypocalcified amelogenesis imperfecta, Witkop type III, was unrelated to previously described mutations in the ENAM or MMP-20 genes PMID: 21504268
MMP-20 is overexpresssed in LSCC compared with the adjacent normal laryngeal epithelium. PMID: 21466263
Associations between tooth agenesis and MMP1 (p=0.007), and MMP20 (p=0.03) were found in Brazilian families. MMP20 continued to be associated with tooth agenesis (p=0.01). Mmp20 was not expressed during the initial stages of tooth development. PMID: 21144496
Enamelysin and collagen XVIII were co-localized in the developing enamel matrix and stratum intermedium and in the enamel-like tumor matrix of odontogenic tumors. PMID: 15296943
A mutation in the MMP-20 gene has been identified and associated with amelogenesis imperfecta. PMID: 15744043
c-Jun is a key regulatory element for MMP-20 expression PMID: 17611094
Binding of the P41T mutant amelogenin for matrix metalloproteinase 20 was significantly lower than that of wild-type amelogenin. PMID: 18434575
A total of 463 individuals from 54 families were evaluated and mutations in the AMEL, ENAM and KLK4 genes were identified. PMID: 18714142
were able to find SNPs in the matrix metallopeptidase gene MMP20(GeneID 9313) that are significantly associated with kidney aging. PMID: 19834535
In a family with a hypomaturation-type enamel defect, mutational and haplotype analyses revealed an amelogenesis imperfecta-causing point mutation in exon 6 of MMP20 that results in a single amino acid substitution in the hemopexin domain. PMID: 19966041

Hide All

Involvement in disease

Amelogenesis imperfecta, hypomaturation type, 2A2 (AI2A2)

Subcellular Location

Secreted, extracellular space, extracellular matrix.

Protein Families

Peptidase M10A family

Tissue Specificity

Expressed specifically in the enamel organ.

Database Links

HGNC: 7167

OMIM: 604629

KEGG: hsa:9313

STRING: 9606.ENSP00000260228

UniGene: Hs.591946

Code	CSB-BP014667HU
Abbreviation	Recombinant Human MMP20 protein
MSDS	MSDS Datasheet
Size	$528
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Matrix metalloproteinase-20 (MMP20)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage