Recombinant Human Matrix metalloproteinase-20 (MMP20)

In Stock
Code CSB-BP014667HU
MSDS
Size $528
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
MMP20
Uniprot No.
Research Area
Others
Alternative Names
AI2A2; Enamel metalloproteinase; Enamelysin; Matrix metalloproteinase 20; Matrix metalloproteinase-20; MMP 20; MMP-20; MMP20; MMP20_HUMAN
Species
Homo sapiens (Human)
Source
Baculovirus
Expression Region
108-483aa
Target Protein Sequence
YRLFPGEPKWKKNTLTYRISKYTPSMSSVEVDKAVEMALQAWSSAVPLSFVRINSGEADIMISFENGDHGDSYPFDGPRGTLAHAFAPGEGLGGDTHFDNAEKWTMGTNGFNLFTVAAHEFGHALGLAHSTDPSALMYPTYKYKNPYGFHLPKDDVKGIQALYGPRKVFLGKPTLPHAPHHKPSIPDLCDSSSSFDAVTMLGKELLLFKDRIFWRRQVHLRTGIRPSTITSSFPQLMSNVDAAYEVAERGTAYFFKGPHYWITRGFQMQGPPRTIYDFGFPRHVQQIDAAVYLREPQKTLFFVGDEYYSYDERKRKMEKDYPKNTEEEFSGVNGQIDAAVELNGYIYFFSGPKTYKYDTEKEDVVSVVKSSSWIGC
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
46.4
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer,50% glycerol
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The plasmid vector incorporates the gene encoding the Human MMP20 protein (108-483aa), generating recombinant plasmid, which is then introduced into baculovirus cells. Selection of positive baculovirus cells is based on their capacity to withstand a particular antibiotic. Subsequently, the baculovirus cells containing the recombinant plasmid are cultivated under conditions that facilitate the expression of the Human MMP20 gene. The protein carries a N-terminal 10xHis tag and C-terminal Myc tag. Following expression, affinity purification is employed to isolate and purify the recombinant Human MMP20 protein from the cell lysate. Denaturing SDS-PAGE is used to resolve the resulting recombinant protein, enabling an estimation of its purity, exceeding 85%.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Degrades amelogenin, the major protein component of the enamel matrix and two of the macromolecules characterizing the cartilage extracellular matrix: aggrecan and the cartilage oligomeric matrix protein (COMP). May play a central role in tooth enamel formation. Cleaves aggrecan at the '360-Asn-|-Phe-361' site.
Gene References into Functions
  1. The levels of MMP20 silencing-induced downregulation differed amongst CSC markers, with ABCG2 and CD44 showing more pronounced downregulations. PMID: 30002682
  2. common variants at 11q22.2 within MMP20 associate with neuroblastoma cases harboring 11q deletion (rs10895322) PMID: 28924153
  3. The article data showed that MMP20 rs1784418 C>T (Matrix metalloproteinase 20) appears to protect against dental caries, but its effects are likely to be more marked in certain populations. PMID: 27992873
  4. DSPP-MMP20 pair may play a role in the normal turnover of cell surface proteins and/or repair of pericellular matrix proteins of the basement membranes in the metabolically active duct epithelial system of the nephrons. PMID: 27666430
  5. Levels of matrix metalloproteinases MMP-19 and MMP-20 expression are significantly increased in pancreatic ductal adenocarcinoma (PDAC). PMID: 26692439
  6. The expression of MMP20 was lower in calcifying cystic odontogenic tumor when compared to all tumors and cysts. PMID: 26558991
  7. The growth of choroidal neovascularization in AMD would be affected by 2 genes: MMP20, a newly confirmed gene expressed in the retina, and ARMS2/HTRA1, a well-known susceptibility gene for AMD. PMID: 26337002
  8. Novel homozygous mutation MMP20 (c.1054G>A, p.Glu352Lys) genes were identified in amelogenesis imperfect consanguinity. Mutant MMP20 was expressed at a normal level but secreted only minimally with proteolytic function. PMID: 26124219
  9. expression of MMP-20 and co-expression and potential interaction with DSPP in human major salivary gland tissues PMID: 25805840
  10. The results identify MMP-20 as a broad activator of pro-KLKs, suggesting the potential for intersection of the KLK and MMP axes under pathological dysregulation of MMP-20 expression. PMID: 23241590
  11. Polymorphisms of MMP7 and MMP20 genes may be surrogate markers to predict long-term outcomes after kidney transplantation. PMID: 23953525
  12. mineralized content slightly decreased; magnesium substituting for calcium in crystal. anomalies affected enamel with minimal interrod enamel; apatite crystals perpendicular to enamel prisms, suggesting possible new role for MMP20 in enamel formation. PMID: 23625376
  13. amelogenesis imperfecta-causing mutations were identified in three of the probands: 2)a novel missense transition mutation in both MMP20 alleles (g.15390A>G; c.611A>G; p.His204Arg) that substituted arginine for histidine. PMID: 23355523
  14. Variation in MMP20 may be associated with caries experience mainly in Caucasian subjects with poor oral health habits. PMID: 22330321
  15. hypocalcified amelogenesis imperfecta, Witkop type III, was unrelated to previously described mutations in the ENAM or MMP-20 genes PMID: 21504268
  16. MMP-20 is overexpresssed in LSCC compared with the adjacent normal laryngeal epithelium. PMID: 21466263
  17. Associations between tooth agenesis and MMP1 (p=0.007), and MMP20 (p=0.03) were found in Brazilian families. MMP20 continued to be associated with tooth agenesis (p=0.01). Mmp20 was not expressed during the initial stages of tooth development. PMID: 21144496
  18. Enamelysin and collagen XVIII were co-localized in the developing enamel matrix and stratum intermedium and in the enamel-like tumor matrix of odontogenic tumors. PMID: 15296943
  19. A mutation in the MMP-20 gene has been identified and associated with amelogenesis imperfecta. PMID: 15744043
  20. c-Jun is a key regulatory element for MMP-20 expression PMID: 17611094
  21. Binding of the P41T mutant amelogenin for matrix metalloproteinase 20 was significantly lower than that of wild-type amelogenin. PMID: 18434575
  22. A total of 463 individuals from 54 families were evaluated and mutations in the AMEL, ENAM and KLK4 genes were identified. PMID: 18714142
  23. were able to find SNPs in the matrix metallopeptidase gene MMP20(GeneID 9313) that are significantly associated with kidney aging. PMID: 19834535
  24. In a family with a hypomaturation-type enamel defect, mutational and haplotype analyses revealed an amelogenesis imperfecta-causing point mutation in exon 6 of MMP20 that results in a single amino acid substitution in the hemopexin domain. PMID: 19966041

Show More

Hide All

Involvement in disease
Amelogenesis imperfecta, hypomaturation type, 2A2 (AI2A2)
Subcellular Location
Secreted, extracellular space, extracellular matrix.
Protein Families
Peptidase M10A family
Tissue Specificity
Expressed specifically in the enamel organ.
Database Links

HGNC: 7167

OMIM: 604629

KEGG: hsa:9313

STRING: 9606.ENSP00000260228

UniGene: Hs.591946

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*