Recombinant Human Metalloproteinase inhibitor 4

Code CSB-EP857872HU
MSDS
Size Pls inquire
Source E.coli
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP857872HU-B
MSDS
Size Pls inquire
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-BP857872HU
MSDS
Size Pls inquire
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-MP857872HU
MSDS
Size Pls inquire
Source Mammalian cell
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
>85% (SDS-PAGE)
Target Names
TIMP4
Uniprot No.
Research Area
Cancer
Alternative Names
Metalloproteinase inhibitor 4; TIMP 4; TIMP metallopeptidase inhibitor 4; TIMP-4; Timp4; TIMP4_HUMAN; Tissue inhibitor of metalloproteinase 4; Tissue inhibitor of metalloproteinases 4
Species
Homo sapiens (Human)
Expression Region
30-224aa
Target Protein Sequence
CSCAPAHPQQHICHSALVIRAKISSEKVVPASADPADTEKMLRYEIKQIKMFKGFEKVKDVQYIYTPFDSSLCGVKLEANSQKQYLLTGQVLSDGKVFIHLCNYIEPWEDLSLVQRESLNHHYHLNCGCQITTCYTVPCTISAPNECLWTDWLLERKLYGYQAQHYVCMKHVDGTCSWYRGHLPLRKEFVDIVQP
Mol. Weight
24.4kD
Protein Length
Full Length of Mature Protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Complexes with metalloproteinases (such as collagenases) and irreversibly inactivates them by binding to their catalytic zinc cofactor. Known to act on MMP-1, MMP-2, MMP-3, MMP-7 and MMP-9.
Gene References into Functions
  1. MMP2/TIMP4 ratio is a marker of disease severity and right ventricular function as well as a predictor for survival and time to clinical worsening in idiopathic pulmonary arterial hypertension. PMID: 28516393
  2. Aspirin-HPR did not affect the translocation and release of MMPs and TIMP-4 from platelets. PMID: 28770228
  3. Combining two biomarkers significantly improved discrimination of AHRE. CONCLUSION: TIMP-4, NT-proANP, NT-proBNP were strongest associated with PAF and AHRE. The discriminatory performance of CHADS2-VASc for PAF was increased by addition of selected biomarkers. PMID: 28431065
  4. Our findings provide new evidence that LOX regulates SNAI2 expression and that SNAI2-mediated TIMP4 secretion plays a role in cancer progression. PMID: 27029493
  5. This report provides the first example that TIMP-4 regulates carcinogenesis through enriching the tumor progenitor cell population in cervical cancer cells. PMID: 26618609
  6. Concluding, miR-200b-3p mediates regulation of TIMP4 expression in prostate cancer but exact mechanism needs to be investigated. PMID: 28028835
  7. regulates carcinogenesis through apoptosis activation in cervical cancer cells PMID: 26291714
  8. Upregulation of plasma TIMP-4 might contribute to PIH [pregnancy-induced hypertension] processes PMID: 25986893
  9. This study provides evidence that the promoter TIMP4 rs3755724 is a new focal epilepsy susceptibility variant that is plausibly involved in inflammation-induced seizures in Malaysian Chinese. PMID: 25595263
  10. Selective myocardial targeting for TIMP-4 induction through either a viral or transgenic approach favorably altered the course of adverse left ventricular remodeling post-myocardial infarction. PMID: 24637197
  11. The rs3755724 in TIMP4 protein was nominally associated with schizophrenia with poor concentration. PMID: 23229788
  12. Heterogeneous methylation in the promoter region of TIMP4 was associated with cancer progression in non-small cell lung cancer. PMID: 22018271
  13. A trend toward increased serum levels of MMP-9/TIMP-4 was found in patients with successful arteriovenous fistulas. PMID: 21620625
  14. Plasma TIMP-4 has a role in the prediction of LV remodeling and the pathophysiology of the heart postinfarction PMID: 21624734
  15. MMP-10 and -7 abundance increased, accompanied by decreased TIMP-4 in dilated cardiomyopathy failing hearts compared with non-failing hearts. PMID: 20219015
  16. TIMP4 expression is a downstream target of GCM1 PMID: 21406447
  17. Expressions of MMP1, MMP9, TIMP4, and EMMPRIN were significantly unbalanced in the myocardium of congestive heart failure patients with rheumatic heart diseases. PMID: 19734590
  18. this work provides the first evidence of a TIMP-4/CD63 association in astrocytoma tumor cells PMID: 20693981
  19. TIMP-4 overexpression is associated with joint tissue remodeling and pathogenesis of osteoarthritic cartilage PMID: 11948685
  20. TIMP-4 is the major intraplatelet matrix metalloproteinase inhibitor and it is involved in regulation of platelet aggregation and recruitment. PMID: 12466243
  21. Progress curve analysis of MMP inhibition by TIMP-4 indicates that association rate constants and inhibition constants are similar to those for other TIMPs; TIMP-4 has a 5-fold lower binding affinity for proMMP-2 than does TIMP-2. PMID: 12475252
  22. Results suggest a functional relationship between TIMP-4 mRNA and MMP-26 mRNA, and possibly a role in human implantation. PMID: 15273280
  23. TIMP-4 displayed negligible activity against TACE, N-TIMP-4 is a slow tight-binding inhibitor with low nanomolar binding affinity PMID: 15713681
  24. TIMP-4 is expressed de novo in cervical cancer PMID: 15816637
  25. In conclusion, the data demonstrate upregulation of TIMP4 in human cardiovascular disorders exhibiting inflammation, suggesting its future use as a novel systemic marker for vascular inflammation. PMID: 16521002
  26. Maximal expression of TIMP-4 in the early and mid-secretory phase suggests its role during implantation and results show that TIMP-4 control the the relaese of MMP-26 in both stroma and uterine fluid. PMID: 16809379
  27. Results indicate that MMP-26 and TIMP-4 may play an integral role during the conversion of high-grade prostatic intraepithelial neoplasia to invasive cancer and may also serve as markers for early prostate cancer diagnosis. PMID: 16940965
  28. Enzyme immunoassays showed the levels of type 4 tissue inhibitor of metalloproteinases were virtually the same in colorectal cancer and mucosa. PMID: 18214300
  29. C/T polymorphism which is located on the 3'-untranslational regions of the TIMP-4 gene might be associated with susceptibility to Osteoarthritis in a Korean population PMID: 18301898
  30. Peroxynitrite-induced nitration and oligomerization of TIMP-4 attenuated its inhibitory activity against MMP-2 activity and endothelial or tumor cell invasiveness. PMID: 18336787
  31. TIMP4 is related to the development of KD with CALs in Korean children. PMID: 19048177
  32. a cardiopulmonary vasculature-specific role of TIMP-4 activation in systemic sclerosis. PMID: 19190762
  33. MMP-3 and TIMP-4 polymorphisms affect angiographic coronary plaque progression in type 2 diabetic and non-diabetic patients PMID: 19376102
  34. TIMP-4 as a simple prognostic marker that may help identify patients with early-stage breast cancer who could benefit from more aggressive treatment at diagnosis PMID: 19700750

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
Protease inhibitor I35 (TIMP) family
Tissue Specificity
Abundant in heart and present at low levels in many other tissues.
Database Links

HGNC: 11823

OMIM: 601915

KEGG: hsa:7079

STRING: 9606.ENSP00000287814

UniGene: Hs.591665

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1