Recombinant Human Metallothionein-2 (MT2A), partial

Code CSB-EP015120HUg5
Abbreviation Recombinant Human MT2A protein, partial
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 95% as determined by SDS-PAGE.
Activity
Not Test
Target Names
MT2A
Uniprot No.
Research Area
Epigenetics and Nuclear Signaling
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-59aa
Target Protein Sequence
MDPNCSCAAGDSCTCAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGASDKCSC
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
15.9 kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-tagged and C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Metallothioneins have a high content of cysteine residues that bind various heavy metals; these proteins are transcriptionally regulated by both heavy metals and glucocorticoids.
Gene References into Functions
  1. this study uncovers an important role for XAF1-MT2A antagonism as a linchpin to govern cell fate under various stressful conditions including heavy metal exposure. PMID: 28507149
  2. There are evidence for implicating MT2A polymorphisms in the development of Sinonasal Inverted Papilloma. The findings also illustrate the key role played by the MT2A gene in inducing an aggressive Schneiderian Papilloma phenotype. PMID: 28432463
  3. MT2A A-5G polymorphism may be associated with risk of developing chronic kidney disease and diabetes. PMID: 27122239
  4. Data suggest that genotype AA for SNP rs28366003 in MT2A is associated with higher blood zinc levels in subjects with diabetes type 2 (with chronic kidney disease) as compared to control subjects. This case-control, genetic association study was conducted in the Czech Republic. PMID: 28059470
  5. We found a significant association of SNP rs28366003 at MT2A gene with susceptibility to the dry form of AMD in a Northern Spanish population. PMID: 28635422
  6. Our results indicated that the rs10636 and rs28366003 polymorphisms in MT2A increased breast cancer risk in Northwest Chinese Han population. PMID: 28228606
  7. the association of the blood lead level and HDL-C may be modified by the MT2A genetic combination PMID: 28391890
  8. The facility of forming bead-like structures at physiological pH for Zn5-MT2a means that Zn7-MT2a can donate up to two Zn(II) to Zn-dependent enzymes. PMID: 28865957
  9. MT2A may be a chemosensitivity indicator in gastric cancer patients receiving docetaxel-based treatment. PMID: 26801633
  10. Underexpression of MT2A is associated with HPV-positive head and neck cancers. PMID: 26666815
  11. HMBOX1 regulates intracellular free zinc level by interacting with MT2A to inhibit apoptosis and promote autophagy in vascular endothelial cells. PMID: 26456220
  12. Polymorphism of Metallothionein 2A modifies Lead Body Burden in workers chronically exposed to the metal. PMID: 26594907
  13. The findings suggest that MT2A gene variation rs28366003 may be implicated in the etiology of sinonasal inverted papilloma in a Polish population PMID: 26036762
  14. Metallothionein 2A affects the cell respiration by suppressing the expression of mitochondrial protein cytochrome c oxidase subunit II. PMID: 25808318
  15. Data suggest that blood metallothionein-2A (MT-2A) expression and serum MT-2A levels could be important prognostic indices of less differentiated, more aggressive breast cancer phenotype. PMID: 26093198
  16. MT2A was down-regulated in renal cell carcinogenesis. PMID: 24662736
  17. In the Han population of China, the gene polymorphism of MT2A-838G/C is correlated to coronary heart disease. PMID: 25555862
  18. Electrospray ionization ion mobility mass spectrometry and molecular dynamics simulations reveal new insights into metal-induced conformational changes and the mechanism for metalation of human metallothionein-2A. PMID: 24918957
  19. MT2A mRNA expression has a significant inverse correlation with Cd and Cu levels in dry inverted papilloma tissue. Inverted papilloma cases with lower average cadmium and copper content were observed to be the most frequent positive MT2A mRNA expression. PMID: 25900616
  20. A genetic variation of MT2A may be a risk factor in laryngeal cancer in a Polish population and the presence of -5 A/G (rs28366003) MT2A gene polymorphism could be considered as a new potential biomarker of the invasive phenotype of laryngeal cancer. PMID: 24952512
  21. -5 A/G SNP in MT2A gene may have an effect on allele-specific gene expression and accumulation of metal levels in laryngeal cancer. PMID: 25157674
  22. These data suggest that the rs28366003 single nucleotide polymorphism in MT2A is associated with risk of breast cancer in Polish population. PMID: 23053628
  23. Low MT2A expression is associateed with lung carcinogenesis. PMID: 23947958
  24. MT2A contributes to chemotherapy resistance in osteosarcoma, an effect partially mediated by zinc chelation. PMID: 24157868
  25. Cotreatment with aryl hydrocarbon receptor agonist and dexamethasone enhances human MT2A gene expression. PMID: 23994556
  26. MT2A might play a tumor suppressive activity through inhibiting NF-kappaB signaling PMID: 23870553
  27. Suggest a potential role of MT-I/II in the proliferation of gastrointestinal stromal tumor cells and disease progression. PMID: 23986211
  28. MiR-23a in amplified 19p13.13 loci targets metallothionein 2A and promotes growth in gastric cancer cells. PMID: 23553990
  29. Data suggest that up-regulation of MT2A expression in hepatic stellate cells down-regulates expression of specific biological markers (alpha-smooth muscle actin; collagen-I; collagenases) and up-regulates others (matrix metalloproteinases 1, 8, 13). PMID: 23620539
  30. Metallothionein overexpression in cardiac myocytes is capable of abolishing an otherwise expected significant diabetic capillary basement membrane thickening. PMID: 23381845
  31. suggest that Mt2a might be involved in insulin resistance through the up-regulation of Mt gene expression, which may lead to the modulation of insulin action in fat cells PMID: 23148893
  32. A significant association between rs28366003 genotype and MT2A expression level is found in prostate cancer patients. PMID: 23466427
  33. findings show 5 MT isoforms were overexpressed in non-small cell lung cancer and overexpression of MT-1F and MT-2A predicted poor outcome; both isoforms may be involved in progression of this cancer type PMID: 23064051
  34. MT-I/II expression was increased in hippocampi from temporal lobe epilepsy. PMID: 23028585
  35. pregnant women with AG genotype for MT2A polymorphism might have high blood lead levels and their newborns may be at risk of low-level cord blood lead variation PMID: 22005883
  36. Investigated whether MT2A gene polymorphisms are associated with a risk of prostate cancer. Three MT2A SNPs were genotyped in 358 prostate cancer cases and 406 population controls; one SNP showed a positive association with prostate cancer. PMID: 22824183
  37. High MT2A is associated with prostate cancer. PMID: 22248277
  38. MT2A -5A/G core promoter region single nucleotide polymorphism has an effect in accumulating placental Cd and transferring maternal to fetal essential micronutrients. PMID: 21328412
  39. these data support that the IL-6 -174 C+ carriers and MT2A -5 G- carriers may be more advantageous for longevity. PMID: 21277639
  40. Highly statistically significant associations are detected between the -5 adenine/guanine core promoter region single nucleotide polymorphism in the MT2A gene and cadmium, lead, and zinc (but not copper) blood levels. PMID: 21767559
  41. Data suggest that increase in cell size, intracellular granulation and megakaryocytic specific antigen expression such as CD41 and CD42, and arresting cell proliferation validate the role of metallothioneins in cell differentiation. PMID: 20127519
  42. MT-I/II may play a key role in IDC proliferation, but is not a useful prognostic factor of this disease PMID: 21868554
  43. MT-2A promotes breast cancer cell invasion by upregulating MMP-9 via AP-1 and NF-kappaB activation. PMID: 21187089
  44. metallothioneins represented by MT-2A capable of protecting against Abeta aggregation and toxicity PMID: 20711450
  45. MT2 diminishes Transthyretin-Abeta binding, whereas MT3 has the opposite effect PMID: 20646067
  46. The core promoter region polymorphism of metallothionein 2A increases the accumulation of Cd in human renal cortex. PMID: 20303360
  47. A --> G single-nucleotide polymorphism was deteceted in metallothionein 2A core promoter region of Turkish population. PMID: 19572214
  48. Transgenic mice overexpressing human metallothionein 2A from a cardiac-specific promoter were protected from doxorubicin cardiotoxicity. MT can protect the heart from oxidative injury only if it is present prior to induction of oxidative stress. PMID: 12192109
  49. Data suggest that the physical interaction of esophageal cancer related gene 2 (ECRG2) and metallothionein 2A (MT2A) may play an important role in the carcinogenesis of esophageal cancer. PMID: 12646258
  50. zinc ion bioavailability by zinc-bound MTs homeostasis is pivotal to reach health longevity and successful ageing. PMID: 12714254

Show More

Hide All

Protein Families
Metallothionein superfamily, Type 1 family
Database Links

HGNC: 7406

OMIM: 156360

KEGG: hsa:4502

STRING: 9606.ENSP00000245185

UniGene: Hs.534330

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*