Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

MT2A

Uniprot No.

P02795

Research Area

Epigenetics and Nuclear Signaling

Alternative Names

MT2A; CES1; MT2; Metallothionein-2; MT-2; Metallothionein-2A; Metallothionein-II; MT-II

Species

Homo sapiens (Human)

Source

Yeast

Expression Region

1-59aa

Target Protein Sequence

MDPNCSCAAGDSCTCAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGASDKCSC
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

7.9kDa

Protein Length

Partial

Tag Info

N-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

To achieve the expression of the recombinant Human MT2A protein in Yeast cells, a DNA fragment encoding the Human MT2A protein (1-59aa) is inserted into a plasmid vector, which is then transferred to Yeast cells. After screening positive cells, they are cultured and induced to generate the MT2A protein. A N-terminal 6xHis tag is attached to the protein. Cells are lysed to collect the recombinant Human MT2A protein, which is purified through affinity purification and then identified using SDS-PAGE and subsequent staining of the gel with Coomassie Brilliant Blue. The purity of the obtained recombinant Human MT2A protein is over 90%.

Target Background

Function

Metallothioneins have a high content of cysteine residues that bind various heavy metals; these proteins are transcriptionally regulated by both heavy metals and glucocorticoids.

Gene References into Functions

this study uncovers an important role for XAF1-MT2A antagonism as a linchpin to govern cell fate under various stressful conditions including heavy metal exposure. PMID: 28507149
There are evidence for implicating MT2A polymorphisms in the development of Sinonasal Inverted Papilloma. The findings also illustrate the key role played by the MT2A gene in inducing an aggressive Schneiderian Papilloma phenotype. PMID: 28432463
MT2A A-5G polymorphism may be associated with risk of developing chronic kidney disease and diabetes. PMID: 27122239
Data suggest that genotype AA for SNP rs28366003 in MT2A is associated with higher blood zinc levels in subjects with diabetes type 2 (with chronic kidney disease) as compared to control subjects. This case-control, genetic association study was conducted in the Czech Republic. PMID: 28059470
We found a significant association of SNP rs28366003 at MT2A gene with susceptibility to the dry form of AMD in a Northern Spanish population. PMID: 28635422
Our results indicated that the rs10636 and rs28366003 polymorphisms in MT2A increased breast cancer risk in Northwest Chinese Han population. PMID: 28228606
the association of the blood lead level and HDL-C may be modified by the MT2A genetic combination PMID: 28391890
The facility of forming bead-like structures at physiological pH for Zn5-MT2a means that Zn7-MT2a can donate up to two Zn(II) to Zn-dependent enzymes. PMID: 28865957
MT2A may be a chemosensitivity indicator in gastric cancer patients receiving docetaxel-based treatment. PMID: 26801633
Underexpression of MT2A is associated with HPV-positive head and neck cancers. PMID: 26666815
HMBOX1 regulates intracellular free zinc level by interacting with MT2A to inhibit apoptosis and promote autophagy in vascular endothelial cells. PMID: 26456220
Polymorphism of Metallothionein 2A modifies Lead Body Burden in workers chronically exposed to the metal. PMID: 26594907
The findings suggest that MT2A gene variation rs28366003 may be implicated in the etiology of sinonasal inverted papilloma in a Polish population PMID: 26036762
Metallothionein 2A affects the cell respiration by suppressing the expression of mitochondrial protein cytochrome c oxidase subunit II. PMID: 25808318
Data suggest that blood metallothionein-2A (MT-2A) expression and serum MT-2A levels could be important prognostic indices of less differentiated, more aggressive breast cancer phenotype. PMID: 26093198
MT2A was down-regulated in renal cell carcinogenesis. PMID: 24662736
In the Han population of China, the gene polymorphism of MT2A-838G/C is correlated to coronary heart disease. PMID: 25555862
Electrospray ionization ion mobility mass spectrometry and molecular dynamics simulations reveal new insights into metal-induced conformational changes and the mechanism for metalation of human metallothionein-2A. PMID: 24918957
MT2A mRNA expression has a significant inverse correlation with Cd and Cu levels in dry inverted papilloma tissue. Inverted papilloma cases with lower average cadmium and copper content were observed to be the most frequent positive MT2A mRNA expression. PMID: 25900616
A genetic variation of MT2A may be a risk factor in laryngeal cancer in a Polish population and the presence of -5 A/G (rs28366003) MT2A gene polymorphism could be considered as a new potential biomarker of the invasive phenotype of laryngeal cancer. PMID: 24952512
-5 A/G SNP in MT2A gene may have an effect on allele-specific gene expression and accumulation of metal levels in laryngeal cancer. PMID: 25157674
These data suggest that the rs28366003 single nucleotide polymorphism in MT2A is associated with risk of breast cancer in Polish population. PMID: 23053628
Low MT2A expression is associateed with lung carcinogenesis. PMID: 23947958
MT2A contributes to chemotherapy resistance in osteosarcoma, an effect partially mediated by zinc chelation. PMID: 24157868
Cotreatment with aryl hydrocarbon receptor agonist and dexamethasone enhances human MT2A gene expression. PMID: 23994556
MT2A might play a tumor suppressive activity through inhibiting NF-kappaB signaling PMID: 23870553
Suggest a potential role of MT-I/II in the proliferation of gastrointestinal stromal tumor cells and disease progression. PMID: 23986211
MiR-23a in amplified 19p13.13 loci targets metallothionein 2A and promotes growth in gastric cancer cells. PMID: 23553990
Data suggest that up-regulation of MT2A expression in hepatic stellate cells down-regulates expression of specific biological markers (alpha-smooth muscle actin; collagen-I; collagenases) and up-regulates others (matrix metalloproteinases 1, 8, 13). PMID: 23620539
Metallothionein overexpression in cardiac myocytes is capable of abolishing an otherwise expected significant diabetic capillary basement membrane thickening. PMID: 23381845
suggest that Mt2a might be involved in insulin resistance through the up-regulation of Mt gene expression, which may lead to the modulation of insulin action in fat cells PMID: 23148893
A significant association between rs28366003 genotype and MT2A expression level is found in prostate cancer patients. PMID: 23466427
findings show 5 MT isoforms were overexpressed in non-small cell lung cancer and overexpression of MT-1F and MT-2A predicted poor outcome; both isoforms may be involved in progression of this cancer type PMID: 23064051
MT-I/II expression was increased in hippocampi from temporal lobe epilepsy. PMID: 23028585
pregnant women with AG genotype for MT2A polymorphism might have high blood lead levels and their newborns may be at risk of low-level cord blood lead variation PMID: 22005883
Investigated whether MT2A gene polymorphisms are associated with a risk of prostate cancer. Three MT2A SNPs were genotyped in 358 prostate cancer cases and 406 population controls; one SNP showed a positive association with prostate cancer. PMID: 22824183
High MT2A is associated with prostate cancer. PMID: 22248277
MT2A -5A/G core promoter region single nucleotide polymorphism has an effect in accumulating placental Cd and transferring maternal to fetal essential micronutrients. PMID: 21328412
these data support that the IL-6 -174 C+ carriers and MT2A -5 G- carriers may be more advantageous for longevity. PMID: 21277639
Highly statistically significant associations are detected between the -5 adenine/guanine core promoter region single nucleotide polymorphism in the MT2A gene and cadmium, lead, and zinc (but not copper) blood levels. PMID: 21767559
Data suggest that increase in cell size, intracellular granulation and megakaryocytic specific antigen expression such as CD41 and CD42, and arresting cell proliferation validate the role of metallothioneins in cell differentiation. PMID: 20127519
MT-I/II may play a key role in IDC proliferation, but is not a useful prognostic factor of this disease PMID: 21868554
MT-2A promotes breast cancer cell invasion by upregulating MMP-9 via AP-1 and NF-kappaB activation. PMID: 21187089
metallothioneins represented by MT-2A capable of protecting against Abeta aggregation and toxicity PMID: 20711450
MT2 diminishes Transthyretin-Abeta binding, whereas MT3 has the opposite effect PMID: 20646067
The core promoter region polymorphism of metallothionein 2A increases the accumulation of Cd in human renal cortex. PMID: 20303360
A --> G single-nucleotide polymorphism was deteceted in metallothionein 2A core promoter region of Turkish population. PMID: 19572214
Transgenic mice overexpressing human metallothionein 2A from a cardiac-specific promoter were protected from doxorubicin cardiotoxicity. MT can protect the heart from oxidative injury only if it is present prior to induction of oxidative stress. PMID: 12192109
Data suggest that the physical interaction of esophageal cancer related gene 2 (ECRG2) and metallothionein 2A (MT2A) may play an important role in the carcinogenesis of esophageal cancer. PMID: 12646258
zinc ion bioavailability by zinc-bound MTs homeostasis is pivotal to reach health longevity and successful ageing. PMID: 12714254

Hide All

Protein Families

Metallothionein superfamily, Type 1 family

Database Links

HGNC: 7406

OMIM: 156360

KEGG: hsa:4502

STRING: 9606.ENSP00000245185

UniGene: Hs.534330

Code	CSB-YP015120HU
Abbreviation	Recombinant Human MT2A protein, partial
MSDS	MSDS Datasheet
Size	$276
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Metallothionein-2 (MT2A), partial

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage