Product Details

Purity

Greater than 95% as determined by SDS-PAGE.

Target Names

FIS1

Uniprot No.

Q9Y3D6

Research Area

Cancer

Alternative Names

FIS1 homolog;Tetratricopeptide repeat protein 11

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

1-122aa

Target Protein Sequence

MEAVLNELVSVEDLLKFEKKFQSEKAAGSVSKSTQFEYAWCLVRSKYNDDIRKGIVLLEELLPKGSKEEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKDG
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

21.1 kDa

Protein Length

Partial

Tag Info

C-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.148.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.

Datasheet & COA

Please contact us to get it.

Target Background

Function

Involved in the fragmentation of the mitochondrial network and its perinuclear clustering. Plays a minor role in the recruitment and association of the fission mediator dynamin-related protein 1 (DNM1L) to the mitochondrial surface and mitochondrial fission. Can induce cytochrome c release from the mitochondrion to the cytosol, ultimately leading to apoptosis. Also mediates peroxisomal fission.

Gene References into Functions

Fis1 depletion in osteoarthritis impairs chondrocyte survival and peroxisomal and lysosomal function. PMID: 27497958
Results show that Fis1 is significantly overexpressed in malignant oncocytomas. PMID: 25822260
Study revealed that a novel mitochondrial fission pathway composed of miR-483-5p and FIS1 regulates cisplatin sensitivity. PMID: 25843291
Overexpression of FoxM1 and Plk1 in Fis1-depleted cells restores mitotic entry. PMID: 23907611
Fis1 expression is significantly increased in spinal cord in a transgenic mouse model of amyotrophic lateral sclerosis. PMID: 23713734
Fis1 acts as a mitochondrial recruitment factor for TBC1D15 that is involved in regulation of mitochondrial morphology. PMID: 23077178
PEX11 proteins attract both Mff and human Fis1 (hFis1) to their site of action. PMID: 22595523
Fis1 and dynamin-related protein (Drp)1 levels are remarkably increased in peripheral blood lymphocytes of Alzheimer's disease patients. PMID: 22340708
Fis1 activity depends on its ability to interconvert between monomer and dimer species PMID: 22789569
The mitochondrial fission protein Fission 1 homologue (Fis1) conveys an apoptosis signal from the mitochondria to the ER by interacting with Bap31 at the ER and facilitating its cleavage into the pro-apoptotic p20Bap31. PMID: 21183955
we observed interactions between Drp1 and Fis1 in mitochondrial fragmentation induced by increasing mitochondrial calcium PMID: 20428767
hFis1 can bind to multiple amino acid sequences selectively, and the tetratricopeptide repeat constitutes the main binding region of hFis1. PMID: 19864424
hFis1 is part of the mammalian fission machinery and regulation of the fission processes might be involved in apoptotic mechanisms PMID: 12783892
regulates mitochondrial fission in mammalian cells through an interaction with the dynamin-like protein DLP1 PMID: 12861026
Cytosolic domain of fis1 adopts a tetratricopeptide repeat domain fold. PMID: 14705031
the level of Fis1 at the mitochondrial surface influences mitochondrial fission events and hence overall mitochondrial morphology within the cell PMID: 14996942
hFis1 induces mitochondrial fragmentation and perinuclear clustering in a state of calcium homeostasis PMID: 15024001
Fis1 together with dynamin-related protein (Drp1) antogonizes Bcl-2. PMID: 16010987
These findings provide the first evidence for a role of Fis1 in peroxisomal fission and suggest that the fission machinery of mitochondria and peroxisomes shares common components. PMID: 16107562
TPR region of hFis1 participates in the interaction with DLP1 or DLP1-containing complex and that the first helix (alpha1) of hFis1 is required for mitochondrial fission presumably by regulating DLP1-hFis1 interaction. PMID: 16118244
Direct induction of mitochondrial elongation by blocking mitochondrial fission process with Fis1-DeltaTM or Drp1-K38A was sufficient to develop senescent phenotypes with increased Reactive oxygen species production. PMID: 16883569
hFis1 is a bifunctional protein that independently regulates mitochondrial fragmentation and endoplasmic reticulum-mediated apoptosis. PMID: 16914522
Fis1 plays important roles in peroxisome division and maintenance of peroxisome morphology in mammalian cells, possibly in a concerted manner with Pex11pbeta and DLP1. PMID: 17408615
hFis1 and OPA1 modulate cellular senescence PMID: 17545159
the concave surface of the Fis1 tetratricopeptide repeat-like domain is evolutionarily conserved to bind the dynamin-like GTPase Dnm1 and not Mdv1 as previously predicted PMID: 17884824
Changes correlate with mitochondrial dysfunction rather than with fragmentation, as substantiated by Fis1 mutants with different effects on organelle shape and function PMID: 18515060
targeting of hFis1 to peroxisomes and mitochondria are independent events and support a direct, Pex19p-dependent targeting of peroxisomal tail-anchored proteins. PMID: 18782765
Fis1 and Mfn1 activities influence mitochondrial signal generation thereby insulin exocytosis. PMID: 18832378
oligomerization of hFis1 in the mitochondrial outer membrane plays a role in mitochondrial fission, potentially through participating in fission factor recruitment. PMID: 18845145

Hide All

Subcellular Location

Mitochondrion outer membrane; Single-pass membrane protein. Peroxisome membrane; Single-pass membrane protein.

Protein Families

FIS1 family

Database Links

HGNC: 21689

OMIM: 609003

KEGG: hsa:51024

STRING: 9606.ENSP00000223136

UniGene: Hs.423968

Message

Product >> Product Name：
Product >> Code：
Name： *
Email： *
Company/Organization：
Phone：
Since emails may get flagged by spam filters occasionally, we recommend leaving your phone number as a precaution. Your information is safe with us.
Question/Comment： *
Your Region： *
I'd like to receive email newsletters from Cusabio

Yes

No
How do you know CUSABIO?

Email

Distributor

Search engine

Advertisement

Others
CAPTCHA verification：
Please enter the characters shown. Click the image to refresh if unclear.

Code	CSB-EP008684HU
Abbreviation	Recombinant Human FIS1 protein, partial
MSDS	MSDS Datasheet
Size	$224
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Mitochondrial fission 1 protein (FIS1), partial

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage