Recombinant Human Mucin-1 (MUC1), partial

In Stock Promotion
Code CSB-MP015215HU2
Abbreviation Recombinant Human MUC1 protein, partial
MSDS
Size $9.9
Promotion
CUSABIO Blowout: 4,100+ In-Stock Proteins
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • The purity of MUC1 was greater than 95% as determined by SEC-HPLC
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Greater than 95% as determined by SEC-HPLC.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Others
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
24-380aa
Target Protein Sequence
SGHASSTPGGEKETSATQRSSVPSSTEKNAVSMTSSVLSSHSPGSGSSTTQGQDVTLAPATEPASGSAATWGQDVTSVPVTRPALGSTTPPAHDVTSAPDNKPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
62.6 kDa
Protein Length
Partial
Tag Info
C-terminal hFc1-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
The alpha subunit has cell adhesive properties. Can act both as an adhesion and an anti-adhesion protein. May provide a protective layer on epithelial cells against bacterial and enzyme attack.; The beta subunit contains a C-terminal domain which is involved in cell signaling, through phosphorylations and protein-protein interactions. Modulates signaling in ERK, SRC and NF-kappa-B pathways. In activated T-cells, influences directly or indirectly the Ras/MAPK pathway. Promotes tumor progression. Regulates TP53-mediated transcription and determines cell fate in the genotoxic stress response. Binds, together with KLF4, the PE21 promoter element of TP53 and represses TP53 activity.
Gene References into Functions
  1. Studied predictive use of mucin 1 (KL-6) serum level as a biomarker in development of bronchopulmonary dysplasia in preterm infants. PMID: 28425256
  2. we wanted to explore whether STAT3 can be related to lymph node micrometastasis of non-small cell lung cancer (NSCLC). To address this question, we evaluated the expression of MUC1 mRNA in the lymph node samples of NSCLC to determine micrometastasis. Then, we evaluated what role STAT3 overexpression plays in lymph node micrometastasis of NSCLC. PMID: 29575778
  3. these data showed that sustained abnormal MUC1 induction accompanies failing epithelial repair, chronic inflammation and kidney fibrosis. In conclusion, MUC1 exerts opposite effects during kidney response to IR: first protective and then harmful PMID: 28366875
  4. The expression profile of studied Mucins MUC16 and MUC1 and truncated O-glycans was not associated with the site of origin of ovarian cancer (OVCA) cell lines PMID: 30011875
  5. MUC1 contributes to immune escape in an aggressive form of triple-negative breast cancer.MUC1 drives PD-L1 expression in triple-negative breast cancer cells. PMID: 29263152
  6. Results show MUC1 expression highly expressed at mRNA and protein levels in esophageal squamous cell carcinoma (ESCC). MUC1 expression correlated with tumor invasion, lymph node metastasis, and TNM staging. PMID: 29798942
  7. Correlation was also observed in the % change of CA 15-3 and CA 27.29 results between consecutive specimens for individual patients. Using doubling or halving thresholds (i.e., 100% increase or 50% decrease), concordance in % change was observed between CA 15-3 and CA 27.29 in approximately 90% of cases. Individual patient results trended similarly across both markers over time PMID: 28929449
  8. Decreased expression of MUC1 is an independent marker for endometrial receptivity in recurrent implantation failure. PMID: 29929546
  9. The glycosylation level of CA153 was found to increase with increasing breast cancer stage in the sandwich assay. The assay system appeared to efficiently discriminate breast cancer stage I (sensitivity: 63%, specificity: 69%), IIA (sensitivity: 77%, specificity: 75%), IIB (sensitivity: 69%, specificity: 86%) and III (sensitivity: 80%, specificity: 65%) from benign breast disease. PMID: 29749490
  10. High MUC1 expression is associated with cervical cancer. PMID: 30062487
  11. KL-6 is an accurate biomarker for the diagnosis of interstitial lung disease in systemic sclerosis. PMID: 29455320
  12. MUC1 was a potential molecular target may help explain the role of lincRNA-ROR/miR-145 for invasion and metastasis in Triple-negative breast cancer cell lines. PMID: 29673594
  13. We have analysed the tumour-associated carbohydrate antigens sialyl-Lewis x (SLe(x)) and sialyl-Tn (STn) on MUC1 and MUC5AC in Pancreatic adenocarcinoma (PDAC)tissues. immunoprecipitation of MUC5AC from positive PDAC tissues and subsequent SLe(x) immunodetection confirmed the presence of SLe(x) on MUC5AC. Altogether, MUC5AC-SLe(x) glycoform is present in PDAC and can be regarded as potential biomarker. PMID: 29408556
  14. High MUC1 expression is associated with breast cancer metastasis. PMID: 29433529
  15. These results revealed that serum WFA-sialylated MUC1 was associated with histological features of hepatocellular carcinoma and recurrence after curative therapy. PMID: 28325920
  16. this study shows that basaloid squamous cell carcinoma and basal cell carcinoma of the head and neck can be readily distinguished by a limited panel consisting primarily of EMA, and supported by SOX2 and p16 PMID: 27438511
  17. In the in vitro tests, JFD-WS effectively inhibited HUVEC proliferation, migration, tube formation and VEGFR2 phosphorylation. Additionally, JFD-WS inhibited the formation of blood vessels in chick chorioallantoic membrane. While inhibiting the xenograft tumor growth in experimental mice, JFD-WS decreased the plasma MUC1 levels PMID: 29436685
  18. Quercetin suppressed breast cancer stem cell proliferation, self-renewal, and invasiveness. It also lowered the expression levels of proteins related to tumorigenesis and cancer progression, such as aldehyde dehydrogenase 1A1, C-X-C chemokine receptor type 4, mucin 1, and epithelial cell adhesion molecules. PMID: 29353288
  19. the proposed ECL immunosensor opened a new era for sensitive CA15-3 evaluation and offered a promising platform for clinical breast cancer diagnostics. PMID: 29278814
  20. MUC1-mediated nucleotide metabolism plays a key role in facilitating radiation resistance in pancreatic cancer and targeted effectively through glycolytic inhibition PMID: 28720669
  21. These findings indicate that decitabine intensifies MUC1-C inhibition induced redox imbalance and provides a novel combination of targeted and epigenetic agents for patients with Cutaneous T-cell lymphoma PMID: 28729399
  22. silencing MUC1 expression inhibited migration and invasion, and induced apoptosis of PANC-1 cells via downregulation of Slug and upregulation of Slug dependent PUMA and E-cadherin expression. PMID: 28869438
  23. this paper shows the role of IgG and Fcgamma receptor genes in endogenous antibody responses to mucin 1 in a large multiethnic cohort of Brazilian patients with breast cancer PMID: 29074302
  24. Frameshift mutation in MUC1 is associated with autosomal dominant tubulointerstitial kidney disease. PMID: 29156055
  25. MUC1 up-regulation is associated with castration-resistant prostate cancer and bone metastasis. PMID: 28930697
  26. As MUC1 and galectin-3 are both commonly overexpressed in most types of epithelial cancers, their interaction and impact on EGFR activation likely makes important contribution to EGFR-associated tumorigenesis and cancer progression. PMID: 28731466
  27. Results identified MUC1 as a novel target of 14-3-3zeta in lung adenocarcinoma. Its high expression is associated with poor survival in lung adenocarcinoma patients. PMID: 28901525
  28. In malignant epithelial ovarian tumors, the positive expression rates of Lewis(y) antigen and MUC1 were 88.33 and 86.67%, respectively, which were markedly higher than those in borderline (60.00 and 53.33%, P<0.05), benign (33.33 and 30%, P<0.01) and normal (0 and 25%, P<0.01) ovarian samples. PMID: 28586014
  29. In uninflamed CD ileum and IBD colon, most barrier gene levels restored to normal, except for MUC1 and MUC4 that remained persistently increased compared with controls. Genetic and transcriptomic dysregulations of key epithelial barrier genes and components in IBD. In particular MUC1 and MUC4, play an essential role in the pathogenesis of IBD and could represent interesting targets for treatment. PMID: 28885228
  30. this study implicates the MUC1 as a critical and dynamic component of the innate host response that limits the severity of influenza and provides the foundation for exploration of MUC1 in resolving inflammatory PMID: 28327617
  31. the observed G1 phase arrest completely agrees with the metabolomics results; MUC1-overexpressing cells under glucose limitation have an altered glutamine metabolism that results in a disruption in de novo pyrimidine synthesis that negatively impacts DNA replication. Moreover, our results provide a clear explanation for the observed glucose dependency of MUC1-overexpressing cells. PMID: 28809118
  32. Data suggest that ositive Mucin-1 (MUC1) expression in cell block cytology specimens may be associated with progressive dilation of the main and ectatic branches of pancreatic ducts. PMID: 28902782
  33. In conclusion, this meta-analysis suggested that rs4245739 polymorphism in the MUC1 gene may play a pivotal role in the pathogenesis of GC, especially for white populations PMID: 28561882
  34. In this paper, a dual-target electrochemical aptasensor has been developed for simultaneous detection of carcinoembryonic antigen and mucin-1 based on metal ion electrochemical labels and Ru(NH3)6(3+) electronic wires PMID: 28732346
  35. MUC1-C is upregulated in triple-negative breast cancer cells resistant to ABT-737 or ABT-263. PMID: 27217294
  36. MUC1 gene interference was done to A549 cells to show its role in sensitivity of lung cancer cells to TNFalpha and DEX. Results of our experiments indicate that MUC1 may regulate the influence of inflammatory mediators in effects of glucocorticoids (GCs), as a regulatory target to improve therapeutics. PMID: 28470556
  37. Mucin 1 is present in intervertebral disc tissue, and its expression is altered in disc degeneration. PMID: 28482827
  38. findings show that transmembrane mucins are receptors for the aggregative adherence fimbriae (AAF) adhesins of enteroaggregative Escherichia coli on the intestinal epithelium; demonstrate that the AAFs elicit intestinal inflammation through MUC1-mediated host cell signaling PMID: 28588132
  39. Report MUC1 gene amplification in association with prostate cancer metastasis and the development of castration resistant prostate cancer. PMID: 27825118
  40. In stage IV breast cancer, circulating antiMUC1 antibody was found to bind serum MUC1 antigen, although their compatibility was low. No significant difference was found in the affinity of the antiMUC1 antibody between stage IV breast cancer and earlystage breast cancer. PMID: 28447743
  41. findings suggest that these pulmonary markers could be useful to assess CAP severity and, especially YKL-40 and CCL18 by helping predict CAP caused by atypical pathogens PMID: 29324810
  42. In this Molecular Pathways article, we briefly discuss the potential role of mucin synthesis in cancers, ways to improve drug delivery and disrupt mucin mesh to overcome chemoresistance by targeting mucin synthesis, and the unique opportunity to target the GCNT3 pathway for the prevention and treatment of cancers. PMID: 28039261
  43. Only EMA was significantly associated with the expressions in circulating tumor cells (CTCs) and tissue. CTC detection was associated with higher T stage and portal vein invasion in hepatocellular carcinomas patients PMID: 27034142
  44. MUC1-C activates the NF-kappaB p65 pathway, promotes occupancy of the MUC1-C/NF-kappaB complex on the DNMT1 promoter and drives DNMT1 transcription PMID: 27259275
  45. MUC1 and MUC4 expression are increased by hypoxia and DNA hypomethylation; this status is statistically associated with development of distant metastasis, tumor stage and overall survival for pancreatic ductal adenocarcinoma (stage IIA and IIB) patients PMID: 27283771
  46. MUC1 enhancement of ERK activation influences FRA-1 activity to modulate tumor migration, invasion and metastasis in a subset of pancreatic cancer cases PMID: 27220889
  47. MUC1 plays an important role in Tumor-associated macrophage-induced lung cancer stem cell progression; pterostilbene may have therapeutic potential for modulating the unfavorable effects of TAMs in lung cancer progression PMID: 27276704
  48. The presence of the MUC1 molecules containing TR subdomain (MUC1-TR) on the surface of low-invasive cancer cells leads to the increase in their transendothelial migration potency, while the addition of the IR subdomain to the MUC1-TR molecule (MUC1-IR-TR) restores their natural low invasiveness. PMID: 28407289
  49. MUC1-driven EGFR expression and signaling regulates proliferation of endometrial cancer cells. PMID: 27092881
  50. MUC1-C binds directly with CD44v and in turn promotes stability of xCT in the cell membrane PMID: 26930718

Show More

Hide All

Involvement in disease
Medullary cystic kidney disease 1 (MCKD1)
Subcellular Location
Apical cell membrane; Single-pass type I membrane protein. Note=Exclusively located in the apical domain of the plasma membrane of highly polarized epithelial cells. After endocytosis, internalized and recycled to the cell membrane. Located to microvilli and to the tips of long filopodial protusions.; [Isoform 5]: Secreted.; [Isoform Y]: Secreted.; [Isoform 9]: Secreted.; [Mucin-1 subunit beta]: Cell membrane. Cytoplasm. Nucleus. Note=On EGF and PDGFRB stimulation, transported to the nucleus through interaction with CTNNB1, a process which is stimulated by phosphorylation. On HRG stimulation, colocalizes with JUP/gamma-catenin at the nucleus.
Tissue Specificity
Expressed on the apical surface of epithelial cells, especially of airway passages, breast and uterus. Also expressed in activated and unactivated T-cells. Overexpressed in epithelial tumors, such as breast or ovarian cancer and also in non-epithelial tum
Database Links

HGNC: 7508

OMIM: 113720

KEGG: hsa:4582

STRING: 9606.ENSP00000357380

UniGene: Hs.89603

CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*