Recombinant Human Muscarinic acetylcholine receptor M3 (CHRM3), partial

In Stock
Code CSB-EP005383HU
Abbreviation Recombinant Human CHRM3 protein, partial
MSDS
Size $224
Order now
Image
  • Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156
  • Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156
  • Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
others
Alternative Names
AChR; ACM3_HUMAN; cholinergic receptor muscarinic 3; CHRM 3; CHRM3; EGBRS; HM 3; HM3; m3 muscarinic acetylcholine receptor; M3 muscarinic receptor; muscarinic 3; Muscarinic acetylcholine receptor M3; muscarinic cholinergic m3 receptor; muscarinic m3 receptor
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
253-492aa
Target Protein Sequence
RIYKETEKRTKELAGLQASGTEAETENFVHPTGSSRSCSSYELQQQSMKRSNRRKYGRCHFWFTTKSWKPSSEQMDQDHSSSDSWNNNDAAASLENSASSDEEDIGSETRAIYSIVLKLPGHSTILNSTKLPSSDNLQVPEEELGMVDLERKADKLQAQKSVDDGGSFPKSFSKLPIQLESAVDTAKTSDVNSSVGKSTATLPLSFKEATLAKRFALKTRSQITKRKRMSLVKEKKAAQT
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
40.7kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-B2M-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer,50% glycerol
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

This recombinant human muscarinic acetylcholine receptor M3 (CHRM3) features a purity greater than 90%, as measured by SDS-PAGE. It is expressed from the expression vector carrying the gene encoding the 253-492aa of human CHRM3 and the N-terminal 6xHis-B2M-tag gene in E. coli. It is available in both liquid and lyophilized forms.

The human CHRM3 is involved in several critical biological processes, including glandular secretion, smooth muscle contraction, and modulation of insulin secretion from pancreatic islets [1][2]. It is predominantly expressed in tissues such as the brain, lungs, and gastrointestinal tract, where it contributes to regulating autonomic functions and influences processes like inflammation and cell proliferation. In the pancreas, CHRM3 is crucial in enhancing glucose-induced insulin secretion. Studies have demonstrated that stimulation of the CHRM3 leads to increased insulin release, which is essential for maintaining glucose homeostasis [1][3]. CHRM3's activation is mediated through phosphorylation processes that enhance its signaling capabilities, particularly in response to agonists like acetylcholine and pilocarpine [4][5].

Dysregulation of CHRM3 has been implicated in various pathophysiological conditions, including asthma, obesity, and certain neurodegenerative diseases. The activation of CHRM3 can promote tumor cell proliferation and migration, particularly in small-cell lung carcinoma and gastric cancer [6][7]. The CHRM3 signaling involves various intracellular pathways, including the activation of protein kinase D1 and the mitogen-activated protein kinase (MAPK) pathway, which are crucial for mediating the effects of M3 receptor activation on cell proliferation and insulin secretion [1][3][8].

References:
[1] K. Kong, A. Butcher, P. McWilliams, D. Jones, J. Wess, F. Hamdanet al., M3-muscarinic receptor promotes insulin release via receptor phosphorylation/arrestin-dependent activation of protein kinase d1, Proceedings of the National Academy of Sciences, vol. 107, no. 49, p. 21181-21186, 2010. https://doi.org/10.1073/pnas.1011651107
[2] T. Renuka, R. Robinson, & C. Paulose, Increased insulin secretion by muscarinic m1 and m3 receptor function from rat pancreatic islets in vitro, Neurochemical Research, vol. 31, no. 3, p. 313-320, 2006. https://doi.org/10.1007/s11064-005-9022-6
[3] A. Duttaroy, C. Zimliki, D. Gautam, Y. Cui, D. Mears, & J. Wess, Muscarinic stimulation of pancreatic insulin and glucagon release is abolished in m3 muscarinic acetylcholine receptor–deficient mice, Diabetes, vol. 53, no. 7, p. 1714-1720, 2004. https://doi.org/10.2337/diabetes.53.7.1714
[4] A. Butcher, R. Prihandoko, K. Kong, P. McWilliams, J. Edwards, A. Bottrillet al., Differential g-protein-coupled receptor phosphorylation provides evidence for a signaling bar code, Journal of Biological Chemistry, vol. 286, no. 13, p. 11506-11518, 2011. https://doi.org/10.1074/jbc.m110.154526
[5] I. Torrecilla, E. Spragg, B. Poulin, P. McWilliams, S. Mistry, A. Blaukatet al., Phosphorylation and regulation of a g protein–coupled receptor by protein kinase ck2, The Journal of Cell Biology, vol. 177, no. 1, p. 127-137, 2007. https://doi.org/10.1083/jcb.200610018
[6] P. Song, H. Sekhon, A. Lu, J. Arredondo, D. Sauer, C. Gravettet al., M3 muscarinic receptor antagonists inhibit small cell lung carcinoma growth and mitogen-activated protein kinase phosphorylation induced by acetylcholine secretion, Cancer Research, vol. 67, no. 8, p. 3936-3944, 2007. https://doi.org/10.1158/0008-5472.can-06-2484
[7] L. Wang, J. Xu, Y. Xia, K. Yin, Z. Li, B. Liet al., Muscarinic acetylcholine receptor 3 mediates vagus nerve-induced gastric cancer, Oncogenesis, vol. 7, no. 11, 2018. https://doi.org/10.1038/s41389-018-0099-6
[8] T. Takahashi, A. Shiraishi, J. Murata, S. Matsubara, S. Nakaoka, S. Kirimotoet al., Muscarinic receptor m3 contributes to intestinal stem cell maintenance via ephb/ephrin-b signaling, Life Science Alliance, vol. 4, no. 9, p. e202000962, 2021. https://doi.org/10.26508/lsa.202000962

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
The muscarinic acetylcholine receptor mediates various cellular responses, including inhibition of adenylate cyclase, breakdown of phosphoinositides and modulation of potassium channels through the action of G proteins. Primary transducing effect is Pi turnover.
Gene References into Functions
  1. M3R activation-induced GRK2 recruitment is Ggamma subtype dependent in which Gbetagamma dimers with low cell membrane-affinity Ggamma9 exhibited a two-fold higher GRK2-recruitment compared to high affinity Ggamma3 expressing cells. PMID: 29864421
  2. Regulation of molecular clock oscillations and phagocytic activity via muscarinic Ca(2+) signaling in human retinal pigment epithelial cells. PMID: 28276525
  3. These results indicate that not H1 but M3 receptor-induced activation of p38 MAPK might contribute to the maintenance of epithelial barrier function through down-regulation of TNF-alpha signalling and activation of EGFR. PMID: 28412413
  4. Morphine-induced MOP receptor endocytosis is facilitated by concurrent M3 activation.M3 and MOP assemble in receptor heterocomplexes mainly located at the plasma membrane.M3-MOP receptor pharmacological interaction is independent of heterocomplex formation.M3 and MOP receptor heteromers disrupt upon both receptor endocytosis. PMID: 28411124
  5. this study shows that anti-M3R is significantly elevated in Sjogren's syndrome plasma in comparison with rheumatoid arthritis, systemic lupus erythematosus, and healthy controls PMID: 27460476
  6. Interacting post-muscarinic receptor signaling pathways potentiate MMP1 expression and invasion of human colon cancer cells. PMID: 28008134
  7. M3R expression plays an important role in early progression and invasion of colon neoplasia but is less important once tumors have spread. PMID: 28416748
  8. This study presents the endocytic pathways of internalization for muscarinic type 3 receptor and flotillin-1/2 in salivary gland epithelial cells. knockdown of flot-1 or -2 by flotillin-specific siRNA prevented internalization and reduced the endocytic efficiency of muscarinic type 3 receptor. PMID: 27221048
  9. M3-mAChR activation leads to enhancement of hsp expression via PKC-dependent phosphorylation of HSF1, thereby stabilizing the mutant hERG-FLAG protein. Thus, M3-mAChR activators may have a therapeutic value for patients with LQT2. PMID: 27803431
  10. There were no significant associations between CHRM3 SNPs and autonomic nervous system activity in patients with schizophrenia on high-dose antipsychotics. PMID: 27923235
  11. our findings support an oncogenic role for the M3 receptor in gastric cancer PMID: 26346168
  12. To our knowledge, this is the first genetic association study that reveals the genetic contribution of CHRM3 gene in bladder cancer etiology. PMID: 28053981
  13. The CHRM3 gene plays a role in abnormal thalamo-orbital frontal cortex functional connectivity in first-episode treatment-naive patients with schizophrenia. PMID: 26959877
  14. These findings indicate that M3 mAChR may be important therapeutic target for obstructive airway diseases, as it regulates the effects of the epithelial-derived chemokines on ASM cell migration, which results in lung remodeling. PMID: 26956674
  15. Blockading CHRM3 by shRNA or treatment with darifenacin inhibited prostate cancer growth. PMID: 26071486
  16. results suggest that the autoantibodies against peptides of the second extracellular loop of M3R are not pathogenic in vivo and they are not suitable as biomarkers for pSS diagnosis PMID: 26901532
  17. Report using biosensing techniques to monitor dynamic changes of inositol lipid pools in living cells reveals a PKC-dependent PtdIns4P increase upon EGF and M3 receptor activation. PMID: 26692031
  18. M3 AChR or AMP-activated protein kinase Small Interfering RNA abrogated the ACh-elicited the attenuation of Endoplasmic reticulum stress in endothelial cells, indicating that the salutary effects of ACh were likely mediated by M3 AChR-AMPK signaling. PMID: 26066647
  19. Suggest Gbeta4gamma1 as a modulator of M3 muscarinic receptor signaling. PMID: 25916507
  20. Cigarette smoking may contribute to this imbalance by affecting the polarization and survival of Th/Tregs through the up-regulation of MR3 and MR5. PMID: 25375131
  21. ACh-induced activation of EGFR/PI3K/AKT pathway and subsequent IL-8 upregulation may be one of the important mechanisms of M3R function PMID: 25964092
  22. an incorrect organizational structure of many mutants of hM3R provides the molecular basis for why they are poorly expressed and fail to be effectively trafficked to the cell surface. PMID: 25769304
  23. M3R preserves the endothelial barrier function through a mechanism potentially maintaining PTP1B activity, keeping the adherens junction proteins (AJPs) dephosphorylation. PMID: 24393526
  24. Results uncovered that Gaq binding to GRK2 enhances the recruitment of GRK2 to M3-ACh receptors. PMID: 25316767
  25. HM3-mediated IL8 expression through PKC-NFkappaB signaling pathways PMID: 24522860
  26. Overexpression of muscarinic receptor 3 promotes metastasis in non-small-cell lung cancer. PMID: 24419413
  27. The presence of muscarinic M3 receptor (HM3) autoantibodies may be related to the underlying disease mechanism in idiopathic generalized anhidrosis patients. PMID: 24334576
  28. The M3 receptor facilitates interaction of the VE-cadherin-based adherens junctional complex and the actin-based cytoskeleton by maintaining Rac1 activity, which regulates the interaction between IQGAP1/Rac1 and IQGAP1/beta-catenin. PMID: 24697698
  29. the M3 muscarinic receptor maximizes the efficiency of PLCbeta3 signaling beyond its canonical role as a guanine nucleotide exchange factor for Galpha. PMID: 24596086
  30. M3-mediated contractions in the M2KO strain were decreased 54% by the protein kinase C (PKC) inhibitor chelerythrine. PMID: 23786223
  31. Data indicate that high M3 muscarinic acetylcholine receptor (M3 receptor) expression correlates with poor survival in non-small cell lung cancer (NSCLC) patients, indicating that M3 receptor may be a novel antineoplastic target. PMID: 23838802
  32. Our findings clearly indicate that binding of anti-M3R autoantibodies to the receptor, which was verified by immunoprecipitation, suppresses AQP5 trafficking to the membrane and contribute to impaired fluid secretion in SjS. PMID: 23382834
  33. CHMR3 at the plasma membrane exists as stable dimeric complexes, a large fraction of which interact dynamically to form tetramers without the presence of trimers, pentamers or higher-order oligomers PMID: 23521066
  34. The acetylcholine M3 receptor was slightly decreased as compared to control in overactive bladder. PMID: 22691178
  35. Results suggest a major role of M(3) muscarinic receptors mediating the human gallbladder contraction through voltage-gated Ca(2+) channels and Rho kinase. PMID: 23227858
  36. Overall, the results of the present study suggest that TNF--alpha causes (1) the release of ACh from A549 cells, (2) the decrease in cholinesterase activity, and (3) the upregulation of M3R expression facilitating the autocrine effects of ACh on M3R. PMID: 23142559
  37. Generalized epilepsies implicates susceptibility genes: CHRM3 at 1q43, VRK2 at 2p16.1, ZEB2 at 2q22.3, SCN1A at 2q24.3 and PNPO at 17q21.32. PMID: 22949513
  38. The expression of mAChR M3 is influenced by the extent of differentiation, distant metastasis and the site of cholangiocarcinoma. It also plays a key role in the proliferation and metastasis of cholangiocarcinoma. PMID: 22893470
  39. CHRM3 and M(3) were suggested to play important roles in the pathogenesis of myopia and in the arrested progression of myopia by atropine. PMID: 22899762
  40. The Asn-7.49 is important for the interaction between M(3)R and ARF1 and also for the formation of the ARF/Rho/beta gamma signaling complex, a complex that might determine the rapid activation and desensitization of PLD.(muscarinic acetylcholine receptor M3) PMID: 22178951
  41. Mutation of this region in the M3-MR altered receptor coupling to G protein. PMID: 22466417
  42. Its cytoprotective effect was decreased by a M3R antagonist. PMID: 22511543
  43. The Asn-514-Tyr point mutation produces constitutive activation of muscarinic M3-AChR by decreasing the rate of receptor deactivation, while having minimal effect on receptor activation. PMID: 22564786
  44. Data suggest that M3 muscarinic receptor and Kir6.1 colocalize to detrusor caveolae; studies include tissue from both male and female subjects. PMID: 22410194
  45. The anti-M3RP205-220 antibody was detected in most patients with Sjogren syndrome. PMID: 22510450
  46. The study reports the results of a combined computational and site mutagenesis study designed to provide new insights into the orthosteric binding site of the human M3 muscarinic acetylcholine receptor. PMID: 22500107
  47. The data provide experimental evidence of the critical role that N-glycan chains play in determining muscarinic receptor distribution, localization, as well as PMID: 21798865
  48. Autoantibodies against the second extra-cellular loop of M3R could be involved in salivary dysfunction in patients with Sjogren's syndrome. PMID: 21877253
  49. Incubation of hSMG cells with pSS IgG (1mg/ml) significantly decreased M3R expression levels at the membrane. PMID: 22137887
  50. Structural basis of M3 muscarinic receptor dimer/oligomer formation. PMID: 21685385

Show More

Hide All

Involvement in disease
Prune belly syndrome (PBS)
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, synapse, postsynaptic cell membrane; Multi-pass membrane protein. Basolateral cell membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family, Muscarinic acetylcholine receptor subfamily, CHRM3 sub-subfamily
Database Links

HGNC: 1952

OMIM: 100100

KEGG: hsa:1131

STRING: 9606.ENSP00000255380

UniGene: Hs.155736

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*