Purity
Greater than 90% as determined by SDS-PAGE.
Alternative Names
AChR; ACM3_HUMAN; cholinergic receptor muscarinic 3; CHRM 3; CHRM3; EGBRS; HM 3; HM3; m3 muscarinic acetylcholine receptor; M3 muscarinic receptor; muscarinic 3; Muscarinic acetylcholine receptor M3; muscarinic cholinergic m3 receptor; muscarinic m3 receptor
Species
Homo sapiens (Human)
Expression Region
253-492aa
Target Protein Sequence
RIYKETEKRTKELAGLQASGTEAETENFVHPTGSSRSCSSYELQQQSMKRSNRRKYGRCHFWFTTKSWKPSSEQMDQDHSSSDSWNNNDAAASLENSASSDEEDIGSETRAIYSIVLKLPGHSTILNSTKLPSSDNLQVPEEELGMVDLERKADKLQAQKSVDDGGSFPKSFSKLPIQLESAVDTAKTSDVNSSVGKSTATLPLSFKEATLAKRFALKTRSQITKRKRMSLVKEKKAAQT
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Tag Info
N-terminal 6xHis-B2M-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer,50% glycerol
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
Amino acids 253-492 form the expressed segment for recombinant Human CHRM3. This CHRM3 protein is expected to have a theoretical molecular weight of 40.7 kDa. This protein is generated in a e.coli-based system. The N-terminal 6xHis-B2M tag was fused into the coding gene segment of CHRM3, making it easier to detect and purify the CHRM3 recombinant protein in the later stages of expression and purification.
Muscarinic acetylcholine receptor M3 (CHRM3) is an important protein in the field of pharmacology and neuroscience, particularly in the study of neurotransmission and its implications for various physiological processes. A major focus of research involves its role in the cholinergic system, specifically in mediating responses to acetylcholine, a neurotransmitter involved in muscle contraction, cognitive function, and autonomic nervous system regulation. In neurobiology, CHRM3 is extensively investigated for its involvement in synaptic transmission and signaling cascades. Moreover, CHRM3 holds significance in clinical research, particularly in the development of drugs targeting the cholinergic system. The receptor's involvement in smooth muscle contraction makes it a potential therapeutic target for conditions like asthma and overactive bladder.