Recombinant Human Muscarinic acetylcholine receptor M3(CHRM3),partial

Code CSB-YP005383HU
Product Type Recombinant Protein
Size US$2010
Uniprot No. P20309
Relevance The muscarinic acetylcholine receptor mediates various cellular responses, including inhibition of adenylate cyclase, breakdown of phosphoinositides and modulation of potassium channels through the action of G proteins. Primary transducing effect is Pi turnover.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence RIYKETEKRTKELAGLQASGTEAETENFVHPTGSSRSCSSYELQQQSMKRSNRRKYGRCHFWFTTKSWKPSSEQMDQDHSSSDSWNNNDAAASLENSASSDEEDIGSETRAIYSIVLKLPGHSTILNSTKLPSSDNLQVPEEELGMVDLERKADKLQAQKSVDDGGSFPKSFSKLPIQLESAVDTAKTSDVNSSVGKSTATLPLSFKEATLAKRFALKTRSQITKRKRMSLVKEKKAAQT
Research Area Neuroscience
Source Yeast
Gene Names CHRM3
Protein Names Recommended name: Muscarinic acetylcholine receptor M3
Expression Region 253-492aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 28.7kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function The muscarinic acetylcholine receptor mediates various cellular responses, including inhibition of adenylate cyclase, breakdown of phosphoinositides and modulation of potassium channels through the action of G proteins. Primary transducing effect is Pi turnover.
Involvement in disease Prune belly syndrome (PBS)
Subcellular Location Cell membrane, Multi-pass membrane protein, Cell junction, synapse, postsynaptic cell membrane, Multi-pass membrane protein, Basolateral cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family, Muscarinic acetylcholine receptor subfamily, CHRM3 sub-subfamily
Database Links

HGNC: 1952

OMIM: 100100

KEGG: hsa:1131

STRING: 9606.ENSP00000255380

UniGene: Hs.155736

Pathway Calcium signaling pathway
Regulation of actin cytoskeleton

Related Products

CHRM3 Antibodies

CHRM3 Antibodies for Human

CHRM3 Antibodies for Homo sapiens (Human)

CHRM3 Proteins

CHRM3 Proteins for Homo sapiens (Human)

CHRM3 ELISA Kit

CHRM3 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.