Recombinant Human Myosin light chain 1/3, skeletal muscle isoform (MYL1)

In Stock
Code CSB-EP015305HU
Abbreviation Recombinant Human MYL1 protein
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
MYL1
Uniprot No.
Research Area
Signal Transduction
Alternative Names
A1 catalytic; Alkali myosin light chain 1; MLC1/MLC3; MLC1F; MLC1F/MLC3F; MLC3F; Myl1; MYL1_HUMAN; Myosin light chain 1 skeletal muscle isoform; Myosin light chain 1/3; Myosin light chain 1/3, skeletal muscle isoform; Myosin light chain A1/A2; Myosin light chain alkali 1/2; skeletal muscle isoform
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-150aa
Target Protein Sequence
MSFSADQIAEFKEAFLLFDRTGDSKITLSQVGDVLRALGTNPTNAEVRKVLGNPSNEELNAKKIEFEQFLPMMQAISNNKDQATYEDFVEGLRVFDKEGNGTVMGAELRHVLATLGEKMKEEEVEALMAGQEDSNGCINYEAFVKHIMSI
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
43.7kDa
Protein Length
Full Length of Isoform MLC3
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Non-regulatory myosin light chain required for proper formation and/or maintenance of myofibers, and thus appropriate muscle function.
Gene References into Functions
  1. MLCK and phosphorylated MLC are potential prognostic indicators of leiomyosarcoma. PMID: 28618653
  2. these results provide new insights into the sequences and modifications of myosin light chain isoforms in the human and swine hearts, which will pave the way for a better understanding of their functional roles in cardiac physiology and pathophysiology. PMID: 28427997
  3. These results support the concept of the ATP-induced transient interaction of the essential light chain-1 N-terminus with the motor domain of the myosin head. PMID: 29102634
  4. polymorphism of intron MYL1 was associated with endurance performance, specifically in endurance trainability, but not genetic predisposition, in human adults. PMID: 26473445
  5. This study provides an additional mechanistic link between Angiotensin II and vasoconstriction via SFK-enhanced MLC phosphorylation in smooth muscle cells. PMID: 26011449
  6. MRK is a novel RhoC effector that controls LPA-stimulated cell invasion at least in part by regulating myosin dynamics, ERK and p38 PMID: 23319595
  7. Disturbed myosin binding of mutated hVLC-1 may provide a pathomechanism for the development of hypertrohic cardiomyopathy. PMID: 22131351
  8. In vitro degradation of human recombinant MLC1 by MMP-2 increased after ONOO(-) exposure of MLC1 in a concentration-dependent manner PMID: 20518849
  9. Influenza infection activates a series of signaling pathways that converge to induce myosin light chain (MLC) phosphorylation and remodeling of the actin cytoskeleton. PMID: 21731751

Show More

Hide All

Database Links

HGNC: 7582

OMIM: 160780

KEGG: hsa:4632

STRING: 9606.ENSP00000307280

UniGene: Hs.187338

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*