Home
Protein
Recombinant Proteins
Recombinant Human Myosin light polypeptide 6 (MYL6), partial

Recombinant Human Myosin light polypeptide 6 (MYL6), partial

^{In Stock}

Code	CSB-RP051544h
Abbreviation	Recombinant Human MYL6 protein, partial
MSDS	MSDS Datasheet
Size	$224
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

MYL6

Uniprot No.

P60660

Research Area

Signal Transduction

Alternative Names

17 kDa myosin light chain; ESMLC; LC 17; LC17; LC17 GI; LC17 NM; LC17A; LC17B; MLC 3; MLC-3; MLC1SM; MLC3; MLC3NM; MLC3SM; MYL 6; MYL6; MYL6_HUMAN; Myosin light chain 3; Myosin light chain 6 alkali smooth muscle and non muscle; Myosin light chain A3; Myosin light chain alkali 3; Myosin light polypeptide 6 alkali smooth muscle and non muscle; Myosin light polypeptide 6; Smooth muscle and non muscle myosin alkali light chain; Smooth muscle and nonmuscle myosin light chain alkali 6

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

3-151aa

Target Protein Sequence

DFTEDQTAEFKEAFQLFDRTGDGKILYSQCGDVMRALGQNPTNAEVLKVLGNPKSDEMNVKVLDFEHFLPMLQTVAKNKDQGTYEDYVEGLRVFDKEGNGTVMGAEIRHVLVTLGEKMTEEEVEMLVAGHEDSNGCINYEAFVRHILSG
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

43.7kDa

Protein Length

Partial

Tag Info

N-terminal GST-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

The recombinant Human MYL6 protein synthesis in e.coli cells necessitates the incorporation of a DNA fragment encoding the Human MYL6 protein (3-151aa) into a plasmid vector, followed by the transformation of this vector into e.coli cells. After screening for positive cells, they are cultured and induced to express the MYL6 protein. The protein carries a N-terminal GST tag. Cell lysis is performed to gather the recombinant Human MYL6 protein, which undergoes affinity purification and is then analyzed using SDS-PAGE and subsequent staining of the gel with Coomassie Brilliant Blue. The purity of the resulting recombinant Human MYL6 protein reaches up to 90%.