Recombinant Human Myristoylated alanine-rich C-kinase substrate (MARCKS), partial

In Stock
Code CSB-EP013493HU2
Abbreviation Recombinant Human MARCKS protein, partial
MSDS
Size $256
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥95% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Signal Transduction
Alternative Names
Protein kinase C substrate, 80 kDa protein, light chain
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-51aa
Target Protein Sequence
MGAQFSKTAAKGEAAAERPGEAAVASSPSKANGQENGHVKVNGDASPAAAE
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
11.8 kDa
Protein Length
Partial
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
MARCKS is the most prominent cellular substrate for protein kinase C. This protein binds calmodulin, actin, and synapsin. MARCKS is a filamentous (F) actin cross-linking protein.
Gene References into Functions
  1. Raman spectra show vibrational bands of Phenylalanine and Lysine residues specific for the protein effector domain, and evidence the presence of alpha helix structure in both configurations. PMID: 28866462
  2. tromal MARCKS overexpression in tumors might contribute to cancer-associated fibroblasts activation and to the poor prognosis of Epithelial ovarian cancer. PMID: 29295532
  3. Study identifies MARCKS phosphorylation at Ser46 is a hallmark of neurite degeneration, the classical hallmark of Alzheimer's disease (AD) pathology. MARCKS phosphorylation is induced by HMGB1 via TLR4. PMID: 27557632
  4. we propose a role for MARCKS in a novel mechanism of BTZ resistance via exocytosis of ubiquitinated proteins in BTZ-resistant cells leading to quenching of proteolytic stress. PMID: 27542283
  5. MARCKS overexpression might in part explain the poor prognosis of inflammatory breast cancer. PMID: 28009981
  6. Authors determined that myristoylated alanine-rich C-kinase substrate (MARCKS) was highly expressed in ovarian stroma, and was required for the differentiation and tumor promoting function of CAFs. PMID: 27081703
  7. Data indicate MARCKS (myristoylated alanine-rich C-kinase substrate) as a target of miR-21. PMID: 27050372
  8. data suggest a major contribution of MARCKS to kidney cancer growth and provide an alternative therapeutic strategy of improving the efficacy of multikinase inhibitors. PMID: 28166200
  9. These data suggested that miR34c3p acts as a tumor suppressor via regulation of MARCKS expression in OS progression PMID: 28075441
  10. Ca(2+)-PKC-MARCKS-PIP2-PI3K-PIP3 system functions as an activation module in vitro PMID: 27119641
  11. Findings show that calmodulin (CaM) stimulates phosphoinositide-3-kinase (PI3K) lipid kinase activity by binding MARCKS and displacing it from phosphatidylinositol 4,5-bisphosphate (PIP2) headgroups, thereby releasing free PIP2 that recruits active PI3K to the membrane and serves as the substrate for the generation of phosphatidylinositol 3,4,5-trisphosphate (PIP3). PMID: 27933776
  12. Findings suggest that MIR429 modulates mucin secretion in human colorectal cells and mouse colitis tissues by up-regulating of MARCKS expression. PMID: 26818658
  13. Knockdown of MARCKS in HepG2 cells reduced cell migration and invasion, but not cell proliferation. PMID: 26722462
  14. MARCKS upregulation increases vascular smooth muscle cell motility by activation of Rac1 and Cdc42, promoting neointima formation. PMID: 26450120
  15. A novel role for MARCKS in regulating nuclear functions such as gene expression. PMID: 26470026
  16. MARCKS knockdown arrested VSMC cell cycle by decreasing KIS expression. Decreased KIS expression resulted in nuclear trapping of p27kip1 in VSMCs. PMID: 26528715
  17. unresponsiveness of breast cancer to paclitaxel treatment is, at least in part, mediated by phospho-MARCKS PMID: 26015406
  18. MARCKS and PPP1R9A might contribute to spine loss in schizophrenia and bipolar disorder through their interactions. PMID: 25757715
  19. isotype delta-PKC is responsible for myristoylated alanine-rich C-kinase substrate (MARCKS) phosphorylation in human neutrophils following f-Met-Leu-Phe stimulation and MARCKS phosphorylation is essential for neutrophil migration and adhesion. PMID: 25515270
  20. A key role of the effector domain of MARCKS in terms of cellular response, particularly to radiation: the importance of MARCKS phosphorylation status for its subcellular localization in lung cancer. PMID: 25524703
  21. MARCKS overexpression was observed in several drug-resistant human myeloma cell lines and in drug-resistant primary multiple myeloma samples. PMID: 25179733
  22. Finding that MARCKS acts as a mediator of apoptosis in microsatellite stable colorectal cancer cells adds a novel tumor-suppressing function to the established roles of MARCKS in cell motility and proliferation. PMID: 24662837
  23. results suggest a key role for MARCKS PSD in cancer disease and provide a unique strategy for inhibiting the activity of MARCKS PSD as a treatment for lung cancer. PMID: 25318062
  24. decreased MARCKS and pMARCKS in the frontal cortex in schizophrenia was found; results suggest a mechanism other than myristoylation was responsible for decreased MARCKS expression in schizophrenia PMID: 24568864
  25. MARCKS may represent a potential biomarker for the prognosis of primary lung SCC. PMID: 24240590
  26. Phospho-MARCKS, a post-translational modification, is associated with cell motility, and has a role in the regulation of cancer cell invasiveness and metastasis. PMID: 24735036
  27. MARCKS is a negative modulator of the acrosomal exocytosis. PMID: 23704996
  28. High MARCKS expression is associated with therapeutic responsiveness in breast cancer. PMID: 23876235
  29. MARCKS plays an articulated role in the progression of colorectal cancer PMID: 23376641
  30. heat shock protein 70 (HSP70) and cysteine string protein (CSP), associate with MARCKS in the secretory mechanism in bronchial epithelial cells PMID: 23377348
  31. Cleavage ofMARCKS by Calpain may have an important role in regulation of the PKC/MARCKS pathway regulating airway mucin secretion PMID: 22710197
  32. These findings implicate that MARCKS is essential for proper cytokinesis and that MARCKS and its partner actin are key mitotic regulators during cell cycle in human hepatic stellate cells. PMID: 22555845
  33. a critical role for H(2)O(2) in angiotensin-II signaling to the endothelial cytoskeleton in a novel pathway that is critically dependent on MARCKS, Rac1, and c-Abl. PMID: 22773836
  34. Relative mRNA expression of MARCKS in white blood cells of O. viverrini-infected patients was higher than in healthy subjects; thus, MARCKS is expressed in macrophages and plays a role in inflammation-related cholangiocarcinoma induced by O. viverrini. PMID: 21763456
  35. BK promotes neurite outgrowth through transient MARCKS phosphorylation involving the PKC-dependent RhoA/ROCK pathway and PP2A in a neuroblastoma cell line. PMID: 21448919
  36. MARCKS and related chaperones bind to unconventional myosin V isoforms in airway epithelial cells PMID: 20203291
  37. reducing MRP expression promotes formation of adherens junctions in EpRas cells, allowing collective cell migration, but interferes with oncogenic beta-catenin signaling and tumorigenesis PMID: 19924305
  38. MARCKS, via its myristoylated aminoterminus, is a key regulator of neutrophil migration and adhesion. PMID: 19574534
  39. role for MARCKS as one of the key players in the migration of CCA cells and suggest that cycling between MARCKS and pMARCKS can regulate the metastasis of biliary cancer cells. PMID: 20047593
  40. Myristoylated alanine-rich C kinase substrate (MARCKS) sequesters spin-labeled phosphatidylinositol 4,5-bisphosphate in lipid bilayers. PMID: 11825894
  41. role in interaction with calmodulin PMID: 14506265
  42. MARCKS proteolysis is necessary for the fusion of myoblasts. PMID: 15239673
  43. MARCKS-mediated neurotensin release occurs via protein kinase C-delta downstream of the Rho/ROK pathwaymediated neurotensin release occurs via protein kinase C-delta downstream of the Rho/ROK pathway PMID: 15623535
  44. elevations in MARCKS expression are detrimental to specific aspects of hippocampal function PMID: 15889447
  45. These findings suggest that some PDBu-induced MARCKS phosphorylation includes the RhoA/ROCK pathway in SH-SY5Y cells. PMID: 16677610
  46. Results suggest that unphosphorylated MARCKS is involved in neurite initiation, and highlight the important role played by MARCKS in organization of the actin cytoskeleton. PMID: 16941482
  47. We suggest that the downregulation of MRP by beta3 is not required for increased cell spreading but instead that MRP downregulation is a secondary effect of increased cell spreading. PMID: 17292354
  48. PKC delta plays an important role in mucin secretion by airway epithelium via regulation of MARCKS phosphorylation. PMID: 18055557
  49. First evidence that cysteine string protein and HSP70, and their interactions with MARCKS, are involved in mucin secretion from airway epithelium. PMID: 18314541
  50. The present study indicates that MARCKS play a major key role in PDGF-BB-induced chemotaxis in activated human hepatic stellate cells. PMID: 18329017

Show More

Hide All

Subcellular Location
Cytoplasm, cytoskeleton. Membrane; Lipid-anchor.
Protein Families
MARCKS family
Database Links

HGNC: 6759

OMIM: 177061

KEGG: hsa:4082

STRING: 9606.ENSP00000357624

UniGene: Hs.519909

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*