Recombinant Human Natriuretic peptides A (NPPA), partial

In Stock
Code CSB-EP016020HU
Abbreviation Recombinant Human NPPA protein, partial
MSDS
Size $306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Others
Alternative Names
Atrial natriuretic factor prohormone;Atrial natriuretic peptide prohormone;Atriopeptigen ;Cardiodilatin;preproCDD-ANF
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
78-115aa
Target Protein Sequence
PEVPPWTGEVSPAQRDGGALGRGPWDSSDRSALLKSKL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
10.9
Protein Length
Partial
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Hormone that plays a key role in mediating cardio-renal homeostasis, and is involved in vascular remodeling and regulating energy metabolism. Acts by specifically binding and stimulating NPR1 to produce cGMP, which in turn activates effector proteins, such as PRKG1, that drive various biological responses. Regulates vasodilation, natriuresis, diuresis and aldosterone synthesis and is therefore essential for regulating blood pressure, controlling the extracellular fluid volume and maintaining the fluid-electrolyte balance. Also involved in inhibiting cardiac remodeling and cardiac hypertrophy by inducing cardiomyocyte apoptosis and attenuating the growth of cardiomyocytes and fibroblasts. Plays a role in female pregnancy by promoting trophoblast invasion and spiral artery remodeling in uterus, and thus prevents pregnancy-induced hypertension. In adipose tissue, acts in various cGMP- and PKG-dependent pathways to regulate lipid metabolism and energy homeostasis. This includes upregulating lipid metabolism and mitochondrial oxygen utilization by activating the AMP-activated protein kinase (AMPK), and increasing energy expenditure by acting via MAPK11 to promote the UCP1-dependent thermogenesis of brown adipose tissue. Binds the clearance receptor NPR3 which removes the hormone from circulation.; May have a role in cardio-renal homeostasis through regulation of natriuresis, diuresis, vasodilation, and inhibiting aldosterone synthesis. In vitro, promotes the production of cGMP and induces vasodilation. May promote natriuresis, at least in part, by enhancing prostaglandin E2 synthesis resulting in the inhibition of renal Na+-K+-ATPase. However reports on the involvement of this peptide in mammal blood volume and blood pressure homeostasis are conflicting; according to a report, in vivo it is not sufficient to activate cGMP and does not inhibit collecting duct transport nor effect diuresis and natriuresis. Appears to bind to specific receptors that are distinct from the receptors bound by atrial natriuretic peptide and vessel dilator. Possibly enhances protein excretion in urine by decreasing proximal tubular protein reabsorption.; May have a role in cardio-renal homeostasis through regulation of natriuresis, diuresis, and vasodilation. In vitro, promotes the production of cGMP and induces vasodilation. May promote natriuresis, at least in part, by enhancing prostaglandin E2 synthesis resulting in the inhibition of renal Na+-K+-ATPase. However reports on the involvement of this peptide in mammal blood volume and blood pressure homeostasis are conflicting; according to a report it is not sufficient to activate cGMP and does not inhibit collecting duct transport nor effect diuresis and natriuresis. Appears to bind to specific receptors that are distinct from the receptors bound by the atrial natriuretic and long-acting natriuretic peptides. Possibly functions in protein excretion in urine by maintaining the integrity of the proximal tubules and enhancing protein excretion by decreasing proximal tubular protein reabsorption.; May have a role in cardio-renal homeostasis through regulation of diuresis and inhibiting aldosterone synthesis. In vitro, promotes the production of cGMP and induces vasodilation. May promote natriuresis, at least in part, by enhancing prostaglandin E2 synthesis resulting in the inhibition of renal Na+-K+-ATPase. May have a role in potassium excretion but not sodium excretion (natriuresis). Possibly enhances protein excretion in urine by decreasing proximal tubular protein reabsorption.; Hormone produced in the kidneys that appears to be important for maintaining cardio-renal homeostasis. Mediates vasodilation, natriuresis and diuresis primarily in the renal system, in order to maintain the extracellular fluid volume and control the fluid-electrolyte balance. Specifically binds and stimulates cGMP production by renal transmembrane receptors, likely NPR1. Urodilatin not ANP, may be the natriuretic peptide responsible for the regulation of sodium and water homeostasis in the kidney.; May have a role in cardio-renal homeostasis through regulation of natriuresis and vasodilation. In vivo promotes natriuresis and in vitro, vasodilates renal artery strips.; May have a role in cardio-renal homeostasis through regulation of natriuresis and vasodilation. In vivo promotes natriuresis and in vitro, vasodilates renal artery strips.; May have a role in cardio-renal homeostasis through regulation of regulation of natriuresis and vasodilation. In vivo promotes natriuresis. In vitro, vasodilates intestinal smooth muscle but not smooth muscle strips.; May have a role in cardio-renal homeostasis through regulation of natriuresis and vasodilation. In vivo promotes natriuresis. In vitro, selectively vasodilates intestinal and vascular smooth muscle strips.; May have a role in cardio-renal homeostasis through regulation of natriuresis and vasodilation. In vivo promotes natriuresis. In vitro, selectively vasodilates intestinal smooth muscle but not vascular smooth muscle strips.
Gene References into Functions
  1. platelet aggregation resulted to be higher in patients with atrial fibrillation carrying the C2238 ANP gene variant with respect to non-carriers. In conclusions, C2238/alphaANP promotes platelet aggregation through the activation of Nox2 and the reduction of cAMP. PMID: 28630469
  2. The results of our study demonstrated that the effect of NPPA SNPs rs5063 and rs198358 on central obesity might be modified by smoking in the Chinese Han population. PMID: 30262711
  3. Upon cardiac stress, Nppa and Nppb are strongly upregulated in the ventricular myocardium. (Review) PMID: 29302701
  4. Suggest that pro-ANP/corin/NPR-C signaling is dominant in the vascular system in preeclampsia. PMID: 29523263
  5. Data indicate the blood pressure-lowering effect of atrial natriuretic peptide (ANP) in the general population. PMID: 29237677
  6. Low circulating MR-proANP at the time of device implantation is associated with cardiac resynchronization therapy response and more favourable outcome. PMID: 28096288
  7. An increase in year-by-year BP variability over the past 6 years is associated with elevated plasma levels of ANP and BNP in the Japanese general population. PMID: 28252040
  8. High plasma levels of MR-proANP are associated with the incidence of atrial fibrillation and stroke in the middle-aged and elderly population. PMID: 28195503
  9. The young adults displayed significant negative associations between MR-proANP and several components of the metabolic syndrome, whereas such associations were not found among the adolescents besides triglycerides and diastolic BP. PMID: 28338810
  10. In summary, there were no significant differences in ANP and BNP levels after percutaneous epicardial left atrial appendage suture ligation using LARIAT device 3 months after procedure. PMID: 28456775
  11. NPPA SNPs were not associated with insulin resistance in older adults. PMID: 27101535
  12. TIMP-4, NT-proANP, NT-proBNP were strongest associated with PAF and AHRE. The discriminatory performance of CHADS2-VASc for PAF was increased by addition of selected biomarkers. PMID: 28431065
  13. the G allele of the genetic variant rs5068 in African Americans is associated with lower prevalence of metabolic syndrome and lower triglycerides values PMID: 29253899
  14. ANP inhibits TGF-beta1-induced EMT in 16HBE-14o and A549 cells through cGMP/PKG signaling, by which it targets TGF-beta1/Smad3 via attenuating phosphorylation of Smad3. These findings suggest the potential of ANP in the treatment on pulmonary diseases with airway remodeling. PMID: 28229930
  15. the ANP T1766C gene polymorphism may be associated with the risk of essential hypertension, and the 1766C allele may be a protective factor against the disease PMID: 27136577
  16. increased plasma proANP should be a protective factor of hyperuricemia among middle-aged and old women PMID: 28076299
  17. Midregional-proANP could accurately detect HF in children and adolescents. Its diagnostic performance was comparable with that of NT-proBNP, regardless of the underlying condition. PMID: 27220692
  18. Corin and atrial natriuretic peptide A were most abundant in the proximal convoluted tubules and the medullary connecting ducts. PMID: 27343265
  19. This study indicates that in children with community-acquired pneumonia, sTREM-1, Midregional-proANP, and Midregional-proADM blood levels have poor abilities to differentiate bacterial from viral diseases or to identify severe cases. PMID: 27846213
  20. Higher levels of PCT, a marker of infection, and MRproANP, a marker for hemodynamic stress, were independently associated with ischemic stroke risk. PCT was specifically associated with small vessel and MRproANP with cardioembolic stroke risk. PMID: 27197849
  21. The present results demonstrate that C2238/ANP-minor allele carrier status is an independent risk factor for acute coronary syndromes recurrence in an Italian cohort of ischemic heart disease patients over the long term, and they support the role of C2238/ANP-minor allele as a negative prognostic factor in coronary artery disease patients. PMID: 25252038
  22. Both NT-proANP and NT-proBNP levels were higher in coronary artery disease patients experiencing MACEs following percutaneous coronary intervention in a non-primary setting. Notably, only NT-proANP levels significantly affected prognosis after PCI. PMID: 26987266
  23. As a risk factor, ANP gene polymorphisms may affect hypertension. Despite the small sample size in this study, it is the first research assessing the ANP gene polymorphisms in both Essential Hypertensive and Type 2 Diabetes Mellitus patients among Malaysian population. PMID: 27413750
  24. The NPPA and NPPB gene polymorphisms are associated with blood pressure in newborns. PMID: 25371308
  25. A panel of three biomarkers (MR-proANP, PCT, and MR-proADM) in patients presenting to the emergency unit with acute dyspnea provides information about the probability of acute heart failure, nonsurvival, and pneumonia. PMID: 26748496
  26. anti-inflammatory and immunomodulatory effect on IL-1beta release and on NF-kB/NALP3/caspase-1 activation PMID: 26616294
  27. prevalence of p.(Ser64Arg) mutation is low in the general population as is the prevalence of atrial fibrillation in mutation carriers PMID: 26200358
  28. Gene polymorphism of ANP (2238T>C) may be associated with developing preeclampsia during pregnancy. PMID: 26686590
  29. C2238/alphaANP downregulates ApoE in vascular smooth muscle cells through type C natriuretic peptide receptor-dependent activation of Egr-1 and the consequent upregulation of miR199a. PMID: 26720342
  30. ANP levels rose steeply after paroxysmal supraventricular tachycardia and then reduced at 30 min after the termination. PMID: 26801306
  31. Age-related elevation of plasma ANP levels preceded the development of CKD in the general population of Japan, raising a possibility for ANP being involved in the development of CKD. PMID: 26499263
  32. N-terminal pro-brain natriuretic PMID: 26244664
  33. Plasma MR-proANP independently predicts all-cause mortality and MACE in patients with STEMI. PMID: 24906365
  34. The C2238/alphaANP variant is a negative modulator of both viability and function of coronary artery smooth muscle cells. PMID: 25401746
  35. Circulating atrial natriuretic peptide genetic association study identifies a novel gene cluster associated with stroke in whites. PMID: 25452597
  36. In this review, we discuss the role of ANP in cardiovascular biology and disease. PMID: 26074089
  37. Our results suggest that the down-regulation of ANP gene expression at mRNA and protein levels and up-regulated CYP11B2 protein expression levels may be correlated with the essential hypertension PMID: 25917967
  38. study to characterize in-depth the cardiovascular and metabolic phenotype associated with rs5068 in a cohort of heart failure patients PMID: 25129277
  39. Three NPPA-NPPB polymorphisms (rs632793, rs198388 and rs198389) were associated with reduced risk of left ventricular dysfunction in CAD patients with hyperlipidemia. PMID: 25400811
  40. plasma mid-regional pro-atrial natriuretic peptide helps predict pre-eclampsia PMID: 24853905
  41. ANP is present in chondrocytes in all the three zones of the articular cartilage, sugesting that ANP may play a role in cartilage metabolism. PMID: 25864764
  42. ANP prevents cancer metastasis by inhibiting the adhesion of tumor cells to inflamed endothelial cells PMID: 25775533
  43. the contribution of ANP in different aspect of innate as well as adaptive immunity also with respect to the excessive cell growth in physiological and/or pathological conditions. PMID: 24973596
  44. NPPA acts on the NPR1 receptor, is expressed in human dorsal root and trigeminal ganglia, and the spinal cord. PMID: 25123163
  45. Elevated levels of NPPA but not of proANP or ANP proteins in left ventricular tissue, may be due to posttranscripcional regulation of NPPA or different pathways for ANP secretion between the atrium and ventricle during heart failure. PMID: 24599027
  46. the ANP genetic polymorphism and serum ANP levels could be potential biomarkers for early detection of ischemic stroke PMID: 24654911
  47. Presence of the rs5065 Atrial natriuretic peptide gene polymorphism is associated with reduced risk of the presence and severity of Coronary artery disease in an Iranian population, independent of the general risk factors of Coronary artery disease. PMID: 24487939
  48. Plasma ANP level was elevated in individuals with sleep disordered breathing among a large Japanese urban population. PMID: 24673969
  49. found a significant negative association between patients' ANP plasma concentrations and anxiety, craving for alcohol and perceived stress. PMID: 24166646
  50. CT-proAVP and MR-proANP have a significant correlation to surrogate markers of the post-cardiac arrest syndrome PMID: 24617620

Show More

Hide All

Involvement in disease
Atrial standstill 2 (ATRST2); Atrial fibrillation, familial, 6 (ATFB6)
Subcellular Location
[Long-acting natriuretic peptide]: Secreted.; [Vessel dilator]: Secreted.; [Kaliuretic peptide]: Secreted.; [Urodilatin]: Secreted.; [Atrial natriuretic peptide]: Secreted. Perikaryon. Cell projection.; [Atriopeptin-3]: Secreted.
Protein Families
Natriuretic peptide family
Tissue Specificity
[Urodilatin]: Detected in the kidney distal tubular cells (at protein level). Present in urine (at protein level).; [Atrial natriuretic peptide]: Detected in atrial and ventricular plasma samples, and in adipocytes (at protein level). Detected in urine in
Database Links

HGNC: 7939

OMIM: 108780

KEGG: hsa:4878

STRING: 9606.ENSP00000365663

UniGene: Hs.75640

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*