Recombinant Human Neurogenic locus notch homolog protein 1 (NOTCH1), partial

In Stock
Code CSB-EP015949HU
Abbreviation Recombinant Human NOTCH1 protein, partial
MSDS
Size $306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 85% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Cardiovascular
Alternative Names
(Notch 1)(hN1)(Translocation-associated notch protein TAN-1)
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
2428-2555aa
Target Protein Sequence
HLGRSFLSGEPSQADVQPLGPSSLAVHTILPQESPALPTSLPSSLVPPVTAAQFLTPPSQHSYSSPVDNTPSHQLQVPEHPFLTPSPESPDQWSSSSPHSNVSDWSEGVSSPPTSMQSQIARIPEAFK
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
48.7 kDa
Protein Length
Partial
Tag Info
N-terminal 10xHis-GST-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Functions as a receptor for membrane-bound ligands Jagged-1 (JAG1), Jagged-2 (JAG2) and Delta-1 (DLL1) to regulate cell-fate determination. Upon ligand activation through the released notch intracellular domain (NICD) it forms a transcriptional activator complex with RBPJ/RBPSUH and activates genes of the enhancer of split locus. Affects the implementation of differentiation, proliferation and apoptotic programs. Involved in angiogenesis; negatively regulates endothelial cell proliferation and migration and angiogenic sprouting. Involved in the maturation of both CD4(+) and CD8(+) cells in the thymus. Important for follicular differentiation and possibly cell fate selection within the follicle. During cerebellar development, functions as a receptor for neuronal DNER and is involved in the differentiation of Bergmann glia. Represses neuronal and myogenic differentiation. May play an essential role in postimplantation development, probably in some aspect of cell specification and/or differentiation. May be involved in mesoderm development, somite formation and neurogenesis. May enhance HIF1A function by sequestering HIF1AN away from HIF1A. Required for the THBS4 function in regulating protective astrogenesis from the subventricular zone (SVZ) niche after injury. Involved in determination of left/right symmetry by modulating the balance between motile and immotile (sensory) cilia at the left-right organiser (LRO).
Gene References into Functions
  1. beta1,4GalTV stimulates transdifferentiation of glioma stem-like cells into endothelial cells by activating Notch1 signaling PMID: 29269413
  2. Expression of translocation-associated notch protein (Notch1) is elevated in patients with chronic hepatitis C (HCV). Inhibition of Notch signaling downregulates HCV-specific Th22 cells and interleukin-22 production, which is accompanied by the reduction of aryl hydrocarbon receptor and modulatory cytokines (IL-6 and tumor necrosis factor-alpha). PMID: 28410452
  3. MiR-497 approximately 195 cluster regulates angiogenesis during coupling with osteogenesis by maintaining endothelial Notch1 and HIF1A activity. PMID: 28685750
  4. The results demonstrated that treatment with norepinephrine(NE) enhanced cell viability and invasion, and inhibited apoptosis of Pancreatic ductal adenocarcinoma (PDAC) cells; however, these effects were suppressed following treatment with Notch1specific siRNA and DAPT. In conclusion, NE may enhance the malignant biological behaviors of PDAC via activating the Notch1 pathway. PMID: 30226612
  5. sinonasal inverted papillomas lesions presented reduced Notch-1 expression compared to nasal polyposis. Dysplastic lesions presented low Notch-1 immunopositivity. Enhancement of Notch-1 gene expression was also associated with inflammation. PMID: 30297114
  6. NOTCH signalling can modulate chromatin structure autonomously and non-autonomously. PMID: 29743479
  7. Notch1 activation and epithelial-mesenchymal transition are coupled to promote squamous cell carcinomas tumor initiation in concert with transforming growth factor (TGF)-beta present in the tumor microenvironment. PMID: 29170450
  8. the reported Dowling-Degos mutations of POFUT1, except for M262T, fail to rescue Notch1 signaling efficiently in the CRISPR-engineered POFUT1-/- background; these studies identify POFUT1 as a potential target for cancers driven by Notch1 mutations and provide a structural roadmap for its inhibition PMID: 28334865
  9. Study reports that IL-17 stimulation induces NOTCH1 activation in oligodendrocyte progenitor cells, contributing to Th17-mediated demyelinating disease. PMID: 28561022
  10. High NOTCH1 expression is associated with endometriosis. PMID: 29398419
  11. Mir-34a regulates cigarette smoke extract-induced respiratory endothelial cell apoptosis by targeting Notch-1 protein. PMID: 29373969
  12. shear stress was able to induce arterial endothelial differentiation of stem cells from human exfoliated deciduous teeth, and VEGF-DLL4/NotchEphrinB2 signaling was involved in this process. PMID: 30015843
  13. Notch1 receptor intracellular domain and Ets-1 cooperatively bind to the DNA of the TRPA1 promoter to up-regulate transcription in the context of living cells. PMID: 28220825
  14. miR-139-5p was identified as a tumour suppressor by negatively targeting Notch1, and this work suggests a possible molecular mechanism of the miR-139/Notch1/EMT axis for glioma treatment. PMID: 30170559
  15. Data suggest that CBX4 expression is up-regulated in breast cancer and is correlated with unfavorable overall survival; CBX4 promotes cell growth and migration via transcriptionally suppressing expression of miR137 to trigger Notch1 signaling pathway. (CBX4 = chromobox homolog 4; miR137 = microRNA 137; Notch1 = neurogenic locus notch homolog protein-1) PMID: 29229426
  16. Data indicate that stanniocalcin 1 (STC1) is a non-canonical NOTCH1 ligand and acts as a crucial regulator of stemness in glioblastoma (GBM). PMID: 29196129
  17. showed here that 3' UTR NOTCH1 mutations are associated with low CD20 expression and with relative resistance to anti-CD20 immunotherapy in vitro PMID: 28550186
  18. MiR92a3p blocks the progression of Wilms tumor by targeting NOTCH1. PMID: 29845267
  19. identified a branch of the XIST/miR-137/Notch-1 pathway that regulates proliferation and TGF-beta1-induced EMT in NSCLC, which could be involved in NSCLC progression PMID: 29812958
  20. In conclusion, we demonstrated that EV71 infection induced elevated expressions of TLR3/4 and Notch1/2 in CD14+ monocytes. PMID: 29702280
  21. Data show that fluid shear stress activates NOTCH signaling, which upregulates GJA4 (commonly, Cx37) and downstream cell cycle inhibitor CDKN1B (p27). PMID: 29247167
  22. EZH2 mutations coexisted with mutations of NOTCH1, IL7R, and PHF6 in the two Adult T-cell Acute Lymphoblastic Leukemia patients, and they responded poorly to chemotherapy and experienced difficult clinical histories and inferior outcomes PMID: 28747286
  23. Crosstalk between TLR4 and Notch1 signaling regulates the inflammatory response in the IgAN and maybe plays an important role in the progression of IgAN. PMID: 29230705
  24. These results suggest that gastric cancer progression is not associated with a unique signaling pathway and that a feedback loop may exist between the HGF/c-Met and Notch1 signaling pathways, which may result in therapeutic resistance. PMID: 29781036
  25. Results indicated that CRNDE functioned as an oncogene in osteosarcoma cell lines, and CRNDE may exert its oncogenic role via regulating Notch1 signaling and EMT in osteosarcoma. PMID: 29246789
  26. NOTCH1 is a central mediator of TGFbetamediated FOXP3 expression and NOTCH1 inhibition produces a significant reduction of melanoma cell proliferation and viability. PMID: 29620159
  27. Study observed membranous Notch1 expression in 31% of the oral leukoplakia (OL) samples. Membranous Notch1 expression was significantly associated with the severity of dysplasia and development of oral squamous cell carcinoma (OSCC). Also, the extent of membranous Notch1 expression was found to increase during carcinogenesis. PMID: 29620248
  28. High NOTCH1 expression is associated with head and neck squamous cell carcinoma. PMID: 29047105
  29. Notch1 role in the angiomyolipoma differentiation.Rheb transcription is regulated by direct Notch1 binding to the Rheb promoter. PMID: 29184052
  30. Notch1 signaling may contribute to the pathogenesis of PV by regulating Th17/Treg immune imbalance. PMID: 29686529
  31. we demonstrate for the first time the presence of NOTCH1 mutation in cases of Hodgkin transformation of B-CLL and outline the clinicopathological characteristics and treatment outcomes for these patients. PMID: 27686521
  32. Endothelial NOTCH1 is responsive to shear stress, and is necessary for the maintenance of junctional integrity, cell elongation, and suppression of proliferation, phenotypes induced by laminar shear stress. PMID: 29158473
  33. Notch1 activation in glioma stem cells specifically induces expression of the long noncoding RNA, TUG1. PMID: 27922002
  34. B-AP15 induced cytotoxic response to hepatocellular carcinoma cells by augmenting ER stress/UPR and inhibiting Wnt/Notch1 signaling pathways. PMID: 29454609
  35. Notch1 is a direct target of miR-449a and positively regulated by circRNA-000911 in breast cancer cell lines. PMID: 29431182
  36. human thymopoiesis involves complex spatiotemporal regulation of Notch ligand expression, which ensures the coordinated delivery of niche-specific NOTCH1 signals required for dynamic T-cell development. PMID: 30042180
  37. Notch1 was confirmed as a target of miR1395p and, showed a marked downregulated expression together with its pathway downstream factors during mesenchymal stem cells osteogenesis. PMID: 29565453
  38. High expression of NOTCH1 was associated with better overall survival in head and neck squamous cell carcinoma. PMID: 29533972
  39. This study identifies the unique role of JAG1-induced Notch activation in the pathogenesis of multiple myeloma PMID: 29242532
  40. Results indicate that lncRNA SNHG1 may be a potential predictor of prognosis in esophageal squamous cell cancer (ESCC) patients, and that knockdown of SNHG1 suppressed the Notch signaling pathway by reducing the Notch1 expression levels in ESCC cells. PMID: 29081407
  41. ATRX, NOTCH1 and NOTCH2 expression varies in angiosarcomas and shows significant correlations with site of origin and poor clinical outcome PMID: 28796347
  42. CK2 inhibitor CX-4945 destabilizes NOTCH1 and synergizes with JQ1 against human T-acute lymphoblastic leukemic cells. PMID: 27758824
  43. Western blotting demonstrated that DUSP1 dephosphorylated pERK and PTEN dephosphorylated pAKT. Collectively, we found a link among HBx, the Notch1 pathway, DUSP1/PTEN, and ERK/AKT pathways, which influenced hepatocellular carcinoma (HCC) cell survival and could be a therapeutic target for HCC treatment. PMID: 29048612
  44. Notch 1 was key in the progression of breast cancer, and knocking down the expression of Notch 1 significantly suppressed the proliferation and invasion of breast cancer cells. PMID: 29207146
  45. Results provide insight into the interrelationship between T-ALL oncogenic networks and the therapeutic efficacy of dual PI3Kgamma/delta inhibition in the context of NOTCH1 and cMYC signaling. PMID: 28716817
  46. Notch1 signaling is an essential downstream pathway of MDM2 in mediating high glucose-induced mitotic catastrophe in podocytes. PMID: 28643424
  47. Effect of Notch1 gene on proliferation and chemo sensitivity of lung cancer A549 cells was studied. PMID: 28678318
  48. results indicate that an ATP2C1/NOTCH1 axis might be critical for keratinocyte function and cutaneous homeostasis, suggesting a plausible model for the pathological features of Hailey-Hailey disease PMID: 27528123
  49. MAFB enhanced leukemogenesis by the naturally occurring Notch1 mutants, decreased disease latency, and increased disease penetrance. PMID: 29138297
  50. the tumorsuppressive roles of miR455 in modulating EOC proliferation and invasion through regulation of Notch1 expression. PMID: 29039517

Show More

Hide All

Involvement in disease
Aortic valve disease 1 (AOVD1); Adams-Oliver syndrome 5 (AOS5)
Subcellular Location
Cell membrane; Single-pass type I membrane protein.; [Notch 1 intracellular domain]: Nucleus.
Protein Families
NOTCH family
Tissue Specificity
In fetal tissues most abundant in spleen, brain stem and lung. Also present in most adult tissues where it is found mainly in lymphoid tissues.
Database Links

HGNC: 7881

OMIM: 109730

KEGG: hsa:4851

STRING: 9606.ENSP00000277541

UniGene: Hs.495473

CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*