Product Details

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Target Names

NMU

Uniprot No.

P48645

Research Area

Cancer

Alternative Names

NMU

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

35-174aa

Target Protein Sequence

ACRGAPILPQGLQPEQQLQLWNEIDDTCSSFLSIDSQPQASNALEELCFMIMGMLPKPQEQDEKDNTKRFLFHYSKTQKLGKSNVVSSVVHPLLQLVPHLHERRMKRFRVDEEFQSPFASQSRGYFLFRPRNGRRSAGFI
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

23.1 kDa

Protein Length

Full Length of Mature Protein

Tag Info

C-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Datasheet & COA

Please contact us to get it.

Target Background

Function

Ligand for receptors NMUR1 and NMUR2. Stimulates muscle contractions of specific regions of the gastrointestinal tract. In humans, NmU stimulates contractions of the ileum and urinary bladder.; Does not function as a ligand for either NMUR1 or NMUR2. Indirectly induces prolactin release although its potency is much lower than that of neuromedin precursor-related peptide 36.; Does not function as a ligand for either NMUR1 or NMUR2. Indirectly induces prolactin release from lactotroph cells in the pituitary gland, probably via the hypothalamic dopaminergic system.

Gene References into Functions

Results identified NMU as highly expressed in non-small cell lung cancer (NSCLC) tissues and cell lines. Furthermore, integrative bioinformatics analyses demonstrate that NMU may confer the alectinib resistance in NSCLC via multiple mechanisms. PMID: 30096454
NMU might contribute to progression of NMUR2-positive breast cancer PMID: 28423716
The anti-tumorigenic effect of HAND2-AS1 in endometrioid endometrial carcinoma was mediated by down-regulating neuromedin U expression. PMID: 29107108
Results indicate a mechanism of action for neuromedin U (NmU) in HER2-overexpressing breast cancer that enhances resistance to HER2-targeted drugs through conferring cancer stem cell (CSC) characteristics and expansion of the CSC phenotype. PMID: 28340506
This study shows an association between a NMU haplotype and anthropometric indices, mainly linked to fat mass, which appears to be age- and sex-specific in children. PMID: 28235053
Overexpression of Nmu may be involved in the process of regional metastasis of HNSCC, and may serve as a novel and valuable biomarker for predicting regional metastasis in patients with HNSCC. PMID: 27279246
polymorphisms in the gene may be useful in identifying women at risk for osteoporosis. PMID: 25871004
our results defined NmU as a candidate drug response biomarker for HER2-overexpressing cancers and as a candidate therapeutic target to limit metastatic progression and improve the efficacy of HER-targeted drugs. PMID: 24876102
a role for NMU gene through interaction with ADRB2 gene in bone strength regulation PMID: 23936460
Inactivation of the von Hippel-Lindau tumour suppressor gene induces Neuromedin U expression in renal cancer cells. PMID: 21791076
[review] Taken together with its vascular actions, NMU may be a functional link between energy balance and the cardiovascular system and may provide a future target for therapies directed against the disorders that comprise metabolic syndrome. PMID: 19519756
These results suggest that NMU plays a role in feeding behavior and catabolic functions via corticotropin-releasing hormone. PMID: 14623274
NmU expression is related to Myb and that the NmU/NMU1R axis constitutes a previously unknown growth-promoting autocrine loop in myeloid leukemia cells PMID: 15187020
irreversible binding of NmU to its receptors PMID: 15331768
Overexpression of neuromedin U is associated with bladder tumor formation, lung metastasis and cancer cachexia PMID: 16878152
Amino acid variants in NMU associate with overweight and obesity, suggesting that NMU is involved in energy regulation in humans. PMID: 16984985
NMU & its cancer-specific receptors, as well as its target genes, are frequently overexpressed in clinical samples of lung cancer and in cell lines, and that those gene products play indispensable roles in the growth and progression of lung cancer cells. PMID: 17018595
NmU may be involved in the HGF-c-Met paracrine loop regulating cell migration, invasiveness and dissemination of pancreatic ductal adenocarcinoma. PMID: 19118941

Hide All

Subcellular Location

Secreted.

Protein Families

NmU family

Tissue Specificity

Expressed throughout the enteric nervous system with highest levels being found in the jejunum.

Database Links

HGNC: 7859

OMIM: 605103

KEGG: hsa:10874

STRING: 9606.ENSP00000264218

UniGene: Hs.418367

Message

Product >> Product Name：
Product >> Code：
Name： *
Email： *
Company/Organization：
Phone：
Since emails may get flagged by spam filters occasionally, we recommend leaving your phone number as a precaution. Your information is safe with us.
Question/Comment： *
Your Region： *
I'd like to receive email newsletters from Cusabio

Yes

No
How do you know CUSABIO?

Email

Distributor

Search engine

Advertisement

Others
CAPTCHA verification：
Please enter the characters shown. Click the image to refresh if unclear.

Code	CSB-EP015902HU
Abbreviation	Recombinant Human NMU protein
MSDS	MSDS Datasheet
Size	$224
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Neuromedin-U (NMU)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage