Recombinant Human Neuropeptide Y receptor type 2 (NPY2R), partial

Code CSB-YP016036HU1
MSDS
Size Pls inquire
Source Yeast
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP016036HU1-B
MSDS
Size Pls inquire
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-BP016036HU1
MSDS
Size Pls inquire
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-MP016036HU1
MSDS
Size Pls inquire
Source Mammalian cell
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
>85% (SDS-PAGE)
Target Names
Uniprot No.
Alternative Names
NPY2R; Neuropeptide Y receptor type 2; NPY2-R; NPY-Y2 receptor; Y2 receptor
Species
Homo sapiens (Human)
Expression Region
326-381
Target Protein Sequence
GWMNSNYRKAFLSAFRCEQRLDAIHSEVSVTFKAKKNLEVRKNSGPNDSFTEATNV
Protein Length
partial, the last Cytoplasmic domain
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for neuropeptide Y and peptide YY. The rank order of affinity of this receptor for pancreatic polypeptides is PYY > NPY > PYY (3-36) > NPY (2-36) > [Ile-31, Gln-34] PP > [Leu-31, Pro-34] NPY > PP, [Pro-34] PYY and NPY free acid.
Gene References into Functions
  1. The present study explored whether functional NPY2R variant rs6857715 (C-599T) showed an association with Major Depressive Disorder. Analysis of the overall sample (595 MDD cases; 1295 controls) showed an association with the AD risk allele C. The present findings suggest that the NPY2R rs6857715 C-allele makes a genuine contribution toward MDD PMID: 27584037
  2. not detected in infantile hemanogiomas PMID: 27889920
  3. polymorphisms in the NPY2R gene may be useful in identifying women at risk for osteoporosis. PMID: 25871004
  4. Data show that the Y2-receptor high expression G allele is associated with a less efficient mode of action cascading where different task goals are activated in parallel. PMID: 25157429
  5. The molecular mobility of the human neuropeptide Y receptor type 2 reconstituted into dimyristoylphosphatidylcholine (DMPC) membranes was investigated by means of solid-state NMR spectroscopy. PMID: 24623336
  6. The results of this study provide evidence that the functionally relevant single nucleotide polymorphism (SNP) in the NPY2R promoter gene affect circumscribed processes of early sensory processing PMID: 24709141
  7. This study reviews neuropeptide Y2 receptor modulators (mainly non-peptidic antagonists) and their structure-activity relationships. PMID: 24365162
  8. this study concludes that common genetic variation in the proximal NPY2R promoter influences transcription factor binding so as to alter gene expression in neuroendocrine cells, and consequently cardiometabolic traits in humans. PMID: 23149563
  9. we determined the role of the C-terminus in the anterograde transport of the human neuropeptide Y receptor (hYR) type 2 PMID: 23020974
  10. Surface masking of the Y2 receptor could to a degree reflect restricted access of the large (34-36-residue) physiological agonists. PMID: 22732667
  11. NPY2R expression in neonatal saliva is predictive of an immature feeding pattern. PMID: 22629465
  12. Four genetic loci were strongly and independently associated with obesity, NPY2R, NPFFR2, MC4R, and FTO. PMID: 21818152
  13. protocol for the preparation of fully active Y2 G protein-coupled receptor PMID: 21999704
  14. Data present a site-directed mutagenesis study of four amino acid positions in the human Y2 receptor. PMID: 21696823
  15. Results report on the functional reconstitution of the hY(2)R and the hY(4)R in Sf9 insect cells using the baculovirus system. PMID: 21745157
  16. Increased expression of NPY-Y2 receptors in symptomatic carotid plaque vascular smooth muscle cells. PMID: 21352822
  17. These results suggest that the rs4425326 polymorphism in NPY2R may be a possible genetic factor for nicotine dependence in the Japanese elderly population. PMID: 20811389
  18. Ligand-induced internalization and recycling of the human neuropeptide Y2 receptor is regulated by its carboxyl-terminal tail PMID: 20959467
  19. effect on metabolic parameters of single nucleotide polymorphisms in the 5'-flanking region of NPY2R gene PMID: 20359722
  20. NPY receptor Y2 polymorphism is independently associated with left ventricular mass index and interacts with plasma levels of NPY in explaining the variability of left ventricular hypertrophy in ESRD. PMID: 20543711
  21. Described is the membrane reconstitution of the refolded human neuropeptide Y receptor Type 2 (Y2 receptor) into phospholipid membranes. PMID: 20421142
  22. Several LEP, and NPY2R and PYY SNPs were associated with obesity-related phenotypes in young adults, particularly among African-Americans. PMID: 20642810
  23. Mutation rate of the rs1047214 polymorphism in NPY2R gene in Chinese adolescents was higher than in foreign populations. Polymorphism seemed to be associated with obesity in males but did not in phenotypes of metabolic syndrome. PMID: 19957593
  24. Report binding and pharmacology of neuropeptide Y Y2 receptor antagonist JNJ-31020028. PMID: 19953226
  25. Peptide YY and neuropeptide Y exert their effects through the NPY2 receptors, which are located on intrinsic neurons as well as epithelia in colon mucosa. PMID: 11906964
  26. tonic activation of submucosal Y(2) receptors could indirectly reduce mucosal ion transport in the colon, while direct activation of Y(2) receptors on longitudinal muscle results in contraction PMID: 12813010
  27. mutations in PYY and Y2R are not commonly found in humans with severe early-onset obesity. PMID: 15331560
  28. High expression of neuropeptide Y receptor Y2 is associated with tumors of the human adrenal gland and extra-adrenal paraganglia PMID: 15623622
  29. Y2R pathway may influence body weight through a sex-specific mechanism. PMID: 15855352
  30. Neuropeptide-Y induced endothelial cell migration was mimicked by agonists and fully blocked by antagonists for any specific NPY receptor (NPY2R). PMID: 16891622
  31. Common variants in the 5' region of NPY2R are associated with obesity in Danish white subjects. PMID: 17019604
  32. A rare variant of the NPY2R gene showed evidence of co-segregation with obesity. PMID: 17235527
  33. NPY2R should be considered a candidate gene for type 2 diabetes in men. PMID: 17325259
  34. In case-control analyses and a family-based association study an association with obesity for seven common variants was not detected; additional gender-stratified analyses were also nonsignificant. PMID: 17992642
  35. The rabbit kidney and the human CHO cell-expressed Y2 dimers are converted by agonists to monomers in vitro at a similar rate in the presence of divalent cations. PMID: 18569526
  36. Y2R gene variants are involved in blood pressure regulation in obese children and adolescents PMID: 18622237
  37. the N-terminal extracellular segment of the neuropeptide Y Y2 receptor thus apparently has a large role in anchoring and compartmentalization of the receptor PMID: 18700141
  38. Single nucleotide polymorphisms in NPY2R provide significant evidence of association with alcohol dependence, alcohol withdrawal symptoms, comorbid alcohol and cocaine dependence, and cocaine dependence. PMID: 18828811

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
High levels in amygdala, corpus callosum, hippocampus and subthalamic nucleus. Also detectable in caudate nucleus, hypothalamus and substantia nigra.
Database Links

HGNC: 7957

OMIM: 162642

KEGG: hsa:4887

STRING: 9606.ENSP00000332591

UniGene: Hs.37125

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×