Recombinant Human Neurotensin/neuromedin N (NTS), partial

In Stock
Code CSB-EP016136HU
Abbreviation Recombinant Human NTS protein, partial
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
NTS
Uniprot No.
Research Area
Neuroscience
Alternative Names
Human proneurotensin; Large neuromedin N; Neuromedin N preproprotein; Neurotensin/neuromedin N; NEUT_HUMAN; NMN 125; NmN; NmN-125; NN; NT; NT/N; NTRH; NTS; NTS1; Pro neurotensin/neuromedin; Proneuromedin N mRNA; Tail peptide
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
24-143aa
Target Protein Sequence
SDSEEEMKALEADFLTNMHTSKISKAHVPSWKMTLLNVCSLVNNLNSPAEETGEVHEEELVARRKLPTALDGFSLEAMLTIYQLHKICHSRAFQHWELIQEDILDTGNDKNGKEEVIKRK
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
29.7kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Neurotensin may play an endocrine or paracrine role in the regulation of fat metabolism. It causes contraction of smooth muscle.
Gene References into Functions
  1. In the elderly population, proneurotensin independently predicts development of cardiovascular diseases in both genders, whereas it only predicts diabetes in women. PMID: 29546332
  2. Neurotensin plasma values differentiate healthy people from patients suffering from colonic pathologies such as adenomatous polyps and adenocarcinoma. PMID: 28560510
  3. NTS may be an important stimulus to promote hepatocellular carcinoma invasion and metastasis both in vitro and in vivo. PMID: 27611941
  4. Higher concentrations of proneurotensin are associated with a greater risk of incident cardiovascular events in the community. This association did not vary according to sex, baseline low-density lipoprotein, or sortilin receptor 1 genotype. PMID: 27312221
  5. sortilin is a PIP3 binding protein with binding likely to occur at the C-terminal neurotensin binding site, and is a competitor of neurotensin PMID: 27666481
  6. children with untreated coeliac disease have elevated peripheral pro-NT levels compared with disease controls. Pro-NT levels also seem to reflect more severe forms of active coeliac disease, indicating a potential role of NT in small intestinal inflammation. PMID: 27612962
  7. findings directly link NT with increased fat absorption and obesity and suggest that NT may provide a prognostic marker of future obesity and a potential target for prevention and treatment PMID: 27193687
  8. Although no measures for pain threshold, thermal instability or gastric motility were performed in our study participants, higher plasma NT levels were found in PWS children PMID: 25847417
  9. pretreatment of gastric cancer cells with NTR1 inhibitor SR48692 was shown to significantly inhibit the NT-mediated MMP-9 activity, cell invasion, and migration PMID: 25724188
  10. NTS/IL-8/CXCR1/STAT3 signaling is crucial for the maintenance of stem-like traits in glioblastoma stem cells . PMID: 25200966
  11. NTS/NTSR1 complex enhances breast tumor aggressiveness via EGFR/HER2/HER3 pathway. PMID: 25249538
  12. Neurotensin and its receptor NTSR1 causes EGFR, HER2 and HER3 over-expression and their autocrine/paracrine activation in lung adenocarcinomas, confirming responsiveness to erlotinib. PMID: 25249545
  13. indicate that neurotensin is a direct target of the Wnt/beta-catenin pathway and may be a mediator for neuroendocrine tumor cell growth PMID: 25098665
  14. The antimicrobial peptide neurotensin has activity against invasive microbes. PMID: 12074933
  15. Results show that both the neurotensin (NT) and the neurotensin 1 receptor hNTS1(321-344)fragment present a 3D structure in complex. PMID: 23140271
  16. NT production by keratinocytes may exert a paracrine effect on other skin cells, namely fibroblasts, macrophages, and dendritic cells for correct wound healing. PMID: 24198343
  17. These findings provide new insights into the potential therapeutic role of NT in chronic wounds, such as in DFU, characterized by a deficit in the migratory properties of cells and a chronic proinflammatory status. PMID: 24000330
  18. Neurotensin-mediated calcium signaling appears more sensitive to differentiation than ATP-mediated Ca(2+) signaling PMID: 23962427
  19. Nanoparticles exposing neurotensin tumor-specific drivers. PMID: 23436714
  20. Data indicate synchronous increase of neurotensin (NTS) and IL-8 in hepatocellular carcinoma (HCC) correlated with worse prognosis and shorten survival after surgery. PMID: 23418512
  21. Proneurotensin expression in the tumor tissues indicated that this precursor was produced by small cell lung carcinoma tumors and secreted into plasma as the tumors grew. PMID: 22825476
  22. a lineage of mature enteroendocrine cells have the ability to coexpress members of a group of functionally related peptides: CCK, secretin, GIP, GLP-1, PYY, and neurotensin PMID: 23064014
  23. NTSR2 was overexpressed, NTSR1 decreased, and neurotensin was not expressed in B cell leukemia patient's B-cells, as compared with healthy B cells. PMID: 23109725
  24. Neurotensin secretion is regulated by PI3 kinase p110 alpha and protein kinase B signaling pathways. PMID: 22700584
  25. Endothelin-converting enzyme-1 (ECE-1) degrades NT in acidic conditions, and its activity is crucial for NTR1 recycling. PMID: 22416137
  26. CD133(+) liver tumor-initiating cells promote tumor angiogenesis, growth, and self-renewal through neurotensin/interleukin-8/CXCL1 signaling. PMID: 21994122
  27. Neurotensin signaling activates microRNAs-21 and -155 and Akt, promotes tumor growth in mice, and is increased in human colon tumors. PMID: 21806946
  28. Neurotensin signaling induces intracellular alkalinization and interleukin-8 expression in human pancreatic cancer cells. PMID: 19393580
  29. determined the status of ERalpha and ERbeta in the myometrium and leiomyomas, atypical leiomyomas and leiomyosarcomas, concomitantly with the expression of NTS/NTS receptor 1 in these tumors PMID: 21623207
  30. Human, pig, and frog NT and [Gln(4)]NT and [D-Tyr(11)]NT adsorbed to the silver surface via the tyrosine ring, the oxygen atom of the deprotonated phenol group of Tyr(11), and the -CH(2)- unit(s), most probably of Tyr(11), Arg(9), and/or Leu(13). PMID: 21542591
  31. study found that inhibition of mTORC1 signaling by rapamycin, torin1, and shRNA-mediated knockdown enhances NT secretion by increasing NT gene expression in the endocrine cell line BON PMID: 21508335
  32. Expression of neurotensin and ghrelin systems are markedly altered in the temporal lobe of Alzheimer's disease patients, which may contribute to the severe cognitive deficit observed in this pathology. PMID: 20858966
  33. Results indicate that the counteraction of neurotensin and neurotensin receptor subtype-1 regulates the genesis and development of pancreatic carcinomas. PMID: 21272935
  34. NT acutely regulates D2 autoreceptor function and DA neuron excitability through PKC-mediated phosphorylation of the D2R, leading to heterologous receptor desensitization. PMID: 21233215
  35. IGF-1R activation represents a previously unrecognized key pathway involved in the mechanisms by which NT and NTR1 modulate colonic inflammation and inflammatory bowel disease. PMID: 21212273
  36. Data show that neurotensin- and NTSR1-positive mmunohistochemistry staining in 60.4% and 59.7% of lung adenocarcinomas, respectively. PMID: 20810387
  37. key regulatory elements in the promoter region that are involved in human NT/N (hNT/N) gene expression PMID: 21030593
  38. Neurotensin is increased in serum of young children with autistic disorder. PMID: 20731814
  39. The expression of NTS is identified as a prognostic marker in patients with malignant pleural mesothelioma. PMID: 19932148
  40. neurotensin /NTR1 signaling in pancreatic cancer cells seems to promote the induction of a metastatic phenotype, in contrast to its varying effects on tumor cell proliferation. PMID: 20138826
  41. The aim of this study was to provide an up-to-date review of the literature concerning the regulatory role of NT on the hypothalamic-anterior pituitary axons--REVIEW PMID: 19878995
  42. topography of its binding site to NT 1 receptor PMID: 11906607
  43. Neurotensin induces protein kinase C-dependent protein kinase D activation and DNA synthesis in human pancreatic carcinoma cell line PANC-1. PMID: 11912133
  44. role in counteracting apoptosis in breast cancer cells PMID: 12150975
  45. Neurotensin expressing neurons develop earlier than vasoactive intestinal polypeptide, vasopressin, and neuropeptide Y expressing neurons in the suprachiasmatic nucleus. (neurotensin) PMID: 12531461
  46. neurotensin has a role in chronic mitogen-activated protein kinase activation and cancer progression PMID: 14699144
  47. Analysis of the NTS genomic sequence revealed 2 intronic polymorphisms and 1 variant located in the 5' untranslated region (UTR). None of the observed variants co-segregated with RLS and no disease-associated polymorphisms were detected PMID: 14743366
  48. neurotensin secretion is mediated by protein kinase C-alpha/-delta and Rho/Rho kinase, and protein kinase D PMID: 15123666
  49. Transcription of NT in the mitochrondria of BON cells in response to pharmacologic manipulation. PMID: 15358593
  50. MARCKS-mediated neurotensin release occurs via protein kinase C-delta downstream of the Rho/ROK pathway PMID: 15623535

Show More

Hide All

Subcellular Location
Secreted. Cytoplasmic vesicle, secretory vesicle. Note=Packaged within secretory vesicles.
Protein Families
Neurotensin family
Database Links

HGNC: 8038

OMIM: 162650

KEGG: hsa:4922

STRING: 9606.ENSP00000256010

UniGene: Hs.80962

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*