Recombinant Human Neutrophil defensin 3 (DEFA3), partial

Code CSB-EP006655HU
Abbreviation Recombinant Human DEFA3 protein, partial
MSDS
Size US$388
Order now
Image
  • Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
DEFA3
Uniprot No.
Research Area
Others
Alternative Names
DEFA3; DEF3Neutrophil defensin 3; Defensin; alpha 3; HNP-3; HP-3; HP3) [Cleaved into: HP 3-56; Neutrophil defensin 2; HNP-2; HP-2; HP2)]
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
39-94aa
Target Protein Sequence
DIPEVVVSLAWDESLAPKHPGSRKNMDCYCRIPACIAGERRYGTCIYQGRLWAFCC
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
22.4 kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Defensin 2 and defensin 3 have antibiotic, fungicide and antiviral activities. Has antimicrobial activity against Gram-negative and Gram-positive bacteria. Defensins are thought to kill microbes by permeabilizing their plasma membrane.
Gene References into Functions
  1. High HNP3 expression is associated with IgA Nephropathy. PMID: 27563166
  2. Elevated DEFA3 levels in diabetes are independent of DEFA3 copy numbers. PMID: 25083086
  3. DEFA3 encodes an antibacterial peptide that is bacteriocidal against S. aureus, E. coli, and P. aeruginosa. PMID: 2997278
  4. alpha-Defensin (DEFA3)was the third most differentially overexpressed gene and may be related to the onset of Bell's palsy and Ramsay Hunt Syndrome. PMID: 22737966
  5. The total amount of gingival crevicular fluid human neutrophil peptide 3 were not different among periodontitis, gingivitis, and health control groups; there was no correlation with clinical periodontal parameters. PMID: 20151808
  6. BPI and HNP 1-3 are accumulated in the synovial cavity of patients with rheumatoid arthritis PMID: 12913926
  7. Aerobic bacteria were 100% susceptible to HBD-2 and HBD-3, whereas only 21.4 and 50% of the anaerobes were susceptible to HBD-2 and HBD-3. PMID: 15004048
  8. HNP-3 is a potentially important regulator of neovascularizaiton, suggesting a new link between inflammation and angiogenesis. PMID: 15208269
  9. We have tested the DEFA3 absence in 697 samples from different human populations. The proportion of subjects lacking DEFA3 varies from 10% to 37%, depending on the population tested, suggesting differences in innate immune function between populations. PMID: 17214878
  10. Clostridium difficile toxin B interacts with high affinity with HNP-3 which may provide a defense mechanism against clostridial glucosylating cytotoxins. PMID: 18435932
  11. Upregulation of HNP3 is associated with colorectal adenomas and carcinomas. PMID: 18957723
  12. Salivary HNP-3concentrations increased following exercise PMID: 19263072
  13. DEFA3 was upregulated in IPF patients with acute exacerbation PMID: 19363140
  14. Studies indicate alpha-defensin, the products of neutrophils wase upregulated at the mRNA and protein levels in SLE patients. PMID: 19758174
  15. Plasma levels of alpha-defensins 1-3 are an indicator of neutrophil activation in pregnant and post-partum women. PMID: 17845323

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
Alpha-defensin family
Database Links

HGNC: 2762

OMIM: 604522

KEGG: hsa:1668

STRING: 9606.ENSP00000328359

UniGene: Hs.654448

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*