Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

NUP210

Uniprot No.

Q8TEM1

Research Area

Transport

Alternative Names

FLJ22389; GP 210; KIAA0906; Nuclear envelope pore membrane protein POM 210; Nuclear pore membrane glycoprotein 210; Nuclear pore protein gp210; Nucleoporin 210; Nucleoporin 210kDa; Nucleoporin Nup210; Nucleoporin210; NUP 210; Nup210; PO210_HUMAN; POM 210; POM210; Pore membrane protein of 210 kDa

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

1529-1808aa

Target Protein Sequence

AVGSVTVYYEVAGHLRTYKEVVVSVPQRIMARHLHPIQTSFQEATASKVIVAVGDRSSNLRGECTPTQREVIQALHPETLISCQSQFKPAVFDFPSQDVFTVEPQFDTALGQYFCSITMHRLTDKQRKHLSMKKTALVVSASLSSSHFSTEQVGAEVPFSPGLFADQAEILLSNHYTSSEIRVFGAPEVLENLEVKSGSPAVLAFAKEKSFGWPSFITYTVGVLDPAAGSQGPLSTTLTFSSPVTNQAIAIPVTVAFVVDRRGPGPYGASLFQHFLDSYQ
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

34.5kDa

Protein Length

Partial

Tag Info

N-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

The recombinant Human NUP210 was expressed with the amino acid range of 1529-1808. The calculated molecular weight for this NUP210 protein is 34.5 kDa. The NUP210 protein was expressed in e.coli. The NUP210 coding gene included the N-terminal 6xHis tag, which simplifies the detection and purification processes of the recombinant NUP210 protein in following stages of expression and purification.

The human nuclear pore membrane glycoprotein 210 (NUP210) is a crucial component of the nuclear pore complex, a structure that regulates the transport of molecules between the nucleus and cytoplasm. NUP210 is localized to the nuclear envelope and is involved in the formation and stabilization of the nuclear pore complex. It plays a key role in nucleocytoplasmic transport, facilitating the selective passage of macromolecules, including proteins and RNA. Additionally, NUP210 has been implicated in the regulation of gene expression and cellular processes related to nuclear envelope dynamics. Research areas involving NUP210 encompass nuclear transport mechanisms, nuclear envelope organization, and the potential impact of NUP210 dysfunction on cellular homeostasis. Understanding NUP210's functions provides insights into fundamental cellular processes and may have implications for various physiological and pathological conditions.

Target Background

Function

Nucleoporin essential for nuclear pore assembly and fusion, nuclear pore spacing, as well as structural integrity.

Gene References into Functions

solution structure of the C-terminal domain PMID: 12653556
gp210 plays critical roles at the nuclear membrane PMID: 14517331
WT1 is probably not regulating GP210 expression, in spite of binding sites for WT1 PMID: 15613247
Quantitation of serusm anti-gp210-C-terminal peptide antibodies is useful for monitoring the effect of ursodeoxycholic acid and for the early identification of patients at high risk for end-stage hepatic failure. PMID: 15710222
The increased expression of gp210 in small bile ducts is possibly involved in autoimmune response to gp210 leading to the progression to end-stage hepatic failure in primary biliary cirrhosis . PMID: 16337775
Double knockdowns of gp210 in HeLa cells suggest that nuclear pore complexes can assemble or at least persist in a gp210-free form. PMID: 16702234

Hide All

Subcellular Location

Nucleus, nuclear pore complex. Nucleus membrane; Single-pass type I membrane protein. Endoplasmic reticulum membrane; Single-pass type I membrane protein.

Protein Families

NUP210 family

Tissue Specificity

Ubiquitous expression, with highest levels in lung, liver, pancreas, testis, and ovary, intermediate levels in brain, kidney, and spleen, and lowest levels in heart and skeletal muscle.

Database Links

HGNC: 30052

OMIM: 607703

KEGG: hsa:23225

STRING: 9606.ENSP00000254508

UniGene: Hs.475525

Code	CSB-EP016195HU(C)
Abbreviation	Recombinant Human NUP210 protein, partial
MSDS	MSDS Datasheet
Size	$224
	Order now
Image	Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Nuclear pore membrane glycoprotein 210 (NUP210), partial

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage