Purity
Greater than 90% as determined by SDS-PAGE.
Alternative Names
FLJ22389; GP 210; KIAA0906; Nuclear envelope pore membrane protein POM 210; Nuclear pore membrane glycoprotein 210; Nuclear pore protein gp210; Nucleoporin 210; Nucleoporin 210kDa; Nucleoporin Nup210; Nucleoporin210; NUP 210; Nup210; PO210_HUMAN; POM 210; POM210; Pore membrane protein of 210 kDa
Species
Homo sapiens (Human)
Expression Region
1529-1808aa
Target Protein Sequence
AVGSVTVYYEVAGHLRTYKEVVVSVPQRIMARHLHPIQTSFQEATASKVIVAVGDRSSNLRGECTPTQREVIQALHPETLISCQSQFKPAVFDFPSQDVFTVEPQFDTALGQYFCSITMHRLTDKQRKHLSMKKTALVVSASLSSSHFSTEQVGAEVPFSPGLFADQAEILLSNHYTSSEIRVFGAPEVLENLEVKSGSPAVLAFAKEKSFGWPSFITYTVGVLDPAAGSQGPLSTTLTFSSPVTNQAIAIPVTVAFVVDRRGPGPYGASLFQHFLDSYQ
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The recombinant Human NUP210 was expressed with the amino acid range of 1529-1808. The calculated molecular weight for this NUP210 protein is 34.5 kDa. The NUP210 protein was expressed in e.coli. The NUP210 coding gene included the N-terminal 6xHis tag, which simplifies the detection and purification processes of the recombinant NUP210 protein in following stages of expression and purification.
The human nuclear pore membrane glycoprotein 210 (NUP210) is a crucial component of the nuclear pore complex, a structure that regulates the transport of molecules between the nucleus and cytoplasm. NUP210 is localized to the nuclear envelope and is involved in the formation and stabilization of the nuclear pore complex. It plays a key role in nucleocytoplasmic transport, facilitating the selective passage of macromolecules, including proteins and RNA. Additionally, NUP210 has been implicated in the regulation of gene expression and cellular processes related to nuclear envelope dynamics. Research areas involving NUP210 encompass nuclear transport mechanisms, nuclear envelope organization, and the potential impact of NUP210 dysfunction on cellular homeostasis. Understanding NUP210's functions provides insights into fundamental cellular processes and may have implications for various physiological and pathological conditions.