Recombinant Human Nuclear pore membrane glycoprotein 210 (NUP210), partial

In Stock
Code CSB-EP016195HU(C)
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
NUP210
Uniprot No.
Research Area
Transport
Alternative Names
FLJ22389; GP 210; KIAA0906; Nuclear envelope pore membrane protein POM 210; Nuclear pore membrane glycoprotein 210; Nuclear pore protein gp210; Nucleoporin 210; Nucleoporin 210kDa; Nucleoporin Nup210; Nucleoporin210; NUP 210; Nup210; PO210_HUMAN; POM 210; POM210; Pore membrane protein of 210 kDa
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1529-1808aa
Target Protein Sequence
AVGSVTVYYEVAGHLRTYKEVVVSVPQRIMARHLHPIQTSFQEATASKVIVAVGDRSSNLRGECTPTQREVIQALHPETLISCQSQFKPAVFDFPSQDVFTVEPQFDTALGQYFCSITMHRLTDKQRKHLSMKKTALVVSASLSSSHFSTEQVGAEVPFSPGLFADQAEILLSNHYTSSEIRVFGAPEVLENLEVKSGSPAVLAFAKEKSFGWPSFITYTVGVLDPAAGSQGPLSTTLTFSSPVTNQAIAIPVTVAFVVDRRGPGPYGASLFQHFLDSYQ
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
34.5kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The recombinant Human NUP210 was expressed with the amino acid range of 1529-1808. The calculated molecular weight for this NUP210 protein is 34.5 kDa. The NUP210 protein was expressed in e.coli. The NUP210 coding gene included the N-terminal 6xHis tag, which simplifies the detection and purification processes of the recombinant NUP210 protein in following stages of expression and purification.

The human nuclear pore membrane glycoprotein 210 (NUP210) is a crucial component of the nuclear pore complex, a structure that regulates the transport of molecules between the nucleus and cytoplasm. NUP210 is localized to the nuclear envelope and is involved in the formation and stabilization of the nuclear pore complex. It plays a key role in nucleocytoplasmic transport, facilitating the selective passage of macromolecules, including proteins and RNA. Additionally, NUP210 has been implicated in the regulation of gene expression and cellular processes related to nuclear envelope dynamics. Research areas involving NUP210 encompass nuclear transport mechanisms, nuclear envelope organization, and the potential impact of NUP210 dysfunction on cellular homeostasis. Understanding NUP210's functions provides insights into fundamental cellular processes and may have implications for various physiological and pathological conditions.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Nucleoporin essential for nuclear pore assembly and fusion, nuclear pore spacing, as well as structural integrity.
Gene References into Functions
  1. solution structure of the C-terminal domain PMID: 12653556
  2. gp210 plays critical roles at the nuclear membrane PMID: 14517331
  3. WT1 is probably not regulating GP210 expression, in spite of binding sites for WT1 PMID: 15613247
  4. Quantitation of serusm anti-gp210-C-terminal peptide antibodies is useful for monitoring the effect of ursodeoxycholic acid and for the early identification of patients at high risk for end-stage hepatic failure. PMID: 15710222
  5. The increased expression of gp210 in small bile ducts is possibly involved in autoimmune response to gp210 leading to the progression to end-stage hepatic failure in primary biliary cirrhosis . PMID: 16337775
  6. Double knockdowns of gp210 in HeLa cells suggest that nuclear pore complexes can assemble or at least persist in a gp210-free form. PMID: 16702234

Show More

Hide All

Subcellular Location
Nucleus, nuclear pore complex. Nucleus membrane; Single-pass type I membrane protein. Endoplasmic reticulum membrane; Single-pass type I membrane protein.
Protein Families
NUP210 family
Tissue Specificity
Ubiquitous expression, with highest levels in lung, liver, pancreas, testis, and ovary, intermediate levels in brain, kidney, and spleen, and lowest levels in heart and skeletal muscle.
Database Links

HGNC: 30052

OMIM: 607703

KEGG: hsa:23225

STRING: 9606.ENSP00000254508

UniGene: Hs.475525

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
webinars: DT3C facilitates antibody internalization X
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*