Name: Recombinant Human Nuclear receptor subfamily 2 group F member 6(NR2F6)
Brand: CUSABIO
SKU: CSB-MP016058HU

Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

NR2F6

Uniprot No.

P10588

Research Area

Epigenetics and Nuclear Signaling

Alternative Names

EAR 2; EAR-2; EAR2; ERBA RELATED 2; ERBA related gene 2; ERBAL2; Nr2f6; NR2F6_HUMAN; Nuclear receptor subfamily 2 group F member 6; Orphan nuclear receptor EAR2 (V erbA related protein EAR 2); v erb a avian erythroblastic leukemia viral oncogene homolog like; V erbA related protein EAR 2; V-erbA-related protein 2

Species

Homo sapiens (Human)

Source

Mammalian cell

Expression Region

1-404aa

Target Protein Sequence

MAMVTGGWGGPGGDTNGVDKAGGYPRAAEDDSASPPGAASDAEPGDEERPGLQVDCVVCGDKSSGKHYGVFTCEGCKSFFKRSIRRNLSYTCRSNRDCQIDQHHRNQCQYCRLKKCFRVGMRKEAVQRGRIPHSLPGAVAASSGSPPGSALAAVASGGDLFPGQPVSELIAQLLRAEPYPAAAGRFGAGGGAAGAVLGIDNVCELAARLLFSTVEWARHAPFFPELPVADQVALLRLSWSELFVLNAAQAALPLHTAPLLAAAGLHAAPMAAERAVAFMDQVRAFQEQVDKLGRLQVDSAEYGCLKAIALFTPDACGLSDPAHVESLQEKAQVALTEYVRAQYPSQPQRFGRLLLRLPALRAVPASLISQLFFMRLVGKTPIETLIRDMLLSGSTFNWPYGSGQ
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.

Mol. Weight

47.0kDa

Protein Length

Full Length

Tag Info

N-terminal 6xHis-Myc-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Tris-based buffer,50% glycerol

Troubleshooting
and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

■ Q&A

We're wondering if it would be possible to be sent the unpurified lysate for CSB-MP016058HU. Would this be something that could be offered to us? We also wanted the purified protein, so could you also provide the unpurified lysate for an extra fee?

Very nice to receive your inquiry. We can provide unpurified lysate for CSB-MP016058HU if you purchase together with the purified protein.
The Cat No of unpurified lysate for CSB-MP016058HU is CSB-ML016058HU.
Recombinant Human Nuclear receptor subfamily 2 group F member 6(NR2F6)
CSB-MP016058HU >> Mammalian cell
Expression Region: 1-404aa; Full length.
Tag information:N-terminal 6xHis-tagged.
Sequence:

Target Background

Function

Transcription factor predominantly involved in transcriptional repression. Binds to promoter/enhancer response elements that contain the imperfect 5'-AGGTCA-3' direct or inverted repeats with various spacings which are also recognized by other nuclear hormone receptors. Involved in modulation of hormonal responses. Represses transcriptional activity of the lutropin-choriogonadotropic hormone receptor/LHCGR gene, the renin/REN gene and the oxytocin-neurophysin/OXT gene. Represses the triiodothyronine-dependent and -independent transcriptional activity of the thyroid hormone receptor gene in a cell type-specific manner. The corepressing function towards thyroid hormone receptor beta/THRB involves at least in part the inhibition of THRB binding to triiodothyronine response elements (TREs) by NR2F6. Inhibits NFATC transcription factor DNA binding and subsequently its transcriptional activity. Acts as transcriptional repressor of IL-17 expression in Th-17 differentiated CD4(+) T cells and may be involved in induction and/or maintenance of peripheral immunological tolerance and autoimmunity. Involved in development of forebrain circadian clock; is required early in the development of the locus coeruleus (LC).

Gene References into Functions

NR2F6 is an intracellular immune checkpoint that suppresses adaptive anti-cancer immune responses PMID: 29670099
Results identified rs2288539 in NR2F6 gene to be associated with poor overall and disease-free survival of patients with an early-stage non-small cell lung cancer. PMID: 28922562
high NR2F6 expression predicts pelvic lymph node metastasis, tumor recurrence and poor prognosis in early-stage cervical cancer. NR2F6 might be a novel prognostic biomarker and potential therapeutic target of cervical cancer. PMID: 27775588
EAR2/NR2F6 and related NRs such as the COUPTFs, TLX and PNR can selectively associate with the developmental corepressor BCL11A via a conserved motif F/YSXXLXXL/Y within the RID1 and RID2 domains. The interaction with BCL11A facilitates COUP-TFII-mediated repression of the RARb2 gene. PMID: 23975195
Interaction of NSD1 with the NR2E/F subfamily including COUP-TFI, COUP-TFII, EAR2 and TLX requires a F/YSXXLXXL/Y motif. NSD1 interaction with liganded NRs is mediated by an overlapping LXXLL motif. PMID: 23975195
study demonstrated that expression of EAR2 was elevated in colorectal cancer and knockdown of EAR2 reduced survivability and tumor growth of colon cancer cells PMID: 21696885
Ear2 ligand binding domain is required for Rasd1 to alleviate Ear2-mediated repression of renin transcription. PMID: 21247419

Hide All

Subcellular Location

Nucleus.

Protein Families

Nuclear hormone receptor family, NR2 subfamily

Tissue Specificity

Expressed in heart, placenta, liver, skeletal muscle, kidney and pancreas.

Database Links

HGNC: 7977

OMIM: 132880

KEGG: hsa:2063

STRING: 9606.ENSP00000291442

UniGene: Hs.466148

CloseMessage

Product >> Product Name：
Product >> Code：
Product >> Size：
Name： *
Email： *
Phone：
We recommend you to leave your phone number because occasionally our emails get flagged by spam filters. We would not disclose any of your private information to any third party.
Question/Comment： *
Your Region： *
Country State：
I'd like to receive email newsletters from Cusabio

Yes

No
How do you know CUSABIO?

Email

Distributor

Search engine

Advertisement

Others
Check Code：

Code	CSB-MP016058HU
Size	US$500
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Nuclear receptor subfamily 2 group F member 6(NR2F6)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

CloseMessage

×CloseMessage