Recombinant Human Odontogenic ameloblast-associated protein(ODAM)

In Stock
Code CSB-EP016268HU
Product Type Recombinant Protein
Size US$1726
Uniprot No. A1E959
Lead Time 3-7 business days
Relevance Tooth-associated epithelia protein that probably plays a role in odontogenesis, the complex process that results in the initiation and generation of the tooth. May be incorporated in the enamel matrix at the end of mineralization process. Involved in the induction of RHOA activity via interaction with ARHGEF and expression of downstream factors such as ROCK. Plays a role in attachment of the junctional epithelium to the tooth surface.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Apin
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence APLIPQRLMSASNSNELLLNLNNGQLLPLQLQGPLNSWIPPFSGILQQQQQAQIPGLSQFSLSALDQFAGLLPNQIPLTGEASFAQGAQAGQVDPLQLQTPPQTQPGPSHVMPYVFSFKMPQEQGQMFQYYPVYMVLPWEQPQQTVPRSPQQTRQQQYEEQIPFYAQFGYIPQLAEPAISGGQQQLAFDPQLGTAPEIAVMSTGEEIPYLQKEAINFRHDSAGVFMPSTSPKPSTTNVFTSAVDQTITPELPEEKDKTDSLREP
Research Area Signal Transduction
Source E.coli
Gene Names ODAM
Protein Names Recommended name: Odontogenic ameloblast-associated protein Alternative name(s): Apin
Expression Region 16-279aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 33.2kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
References
Still Have Questions? Leave a Message or Start an on-line Chat
Function Tooth-associated epithelia protein that probably plays a role in odontogenesis, the complex process that results in the initiation and generation of the tooth. May be incorporated in the enamel matrix at the end of mineralization process. Involved in the induction of RHOA activity via interaction with ARHGEF and expression of downstream factors such as ROCK. Plays a role in attachment of the junctional epithelium to the tooth surface.
Subcellular Location Secreted, Cytoplasm, Nucleus
Protein Families ODAM family
Tissue Specificity Expressed in the junctional epithelium of healthy teeth. In periodontitis, absent in the pocket epithelium of the diseased periodontium but is detected in the gingival crevicular fluid.
Database Links

HGNC: 26043

OMIM: 614843

KEGG: hsa:54959

STRING: 9606.ENSP00000379401

UniGene: Hs.143811

Related Products

ODAM Antibodies

ODAM Antibodies for Homo sapiens (Human)

ODAM Proteins

ODAM Proteins for Homo sapiens (Human)

ODAM ELISA Kit

ODAM ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.