Recombinant Human Oligodendrocyte transcription factor 1 (OLIG1), partial

Code CSB-YP016328HU
Abbreviation Recombinant Human OLIG1 protein, partial
MSDS
Size US$306
Order now
Image
  • Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
OLIG1
Uniprot No.
Research Area
Neuroscience
Alternative Names
Basic domain helix loop helix protein class B 6; Basic domain helix loop helix protein class B6; BHLH B6; BHLHB 6; bHLHb6; bHLHe21; Class B basic helix-loop-helix protein 6; Class E basic helix-loop-helix protein 21; Olig 1; Olig1; OLIG1_HUMAN; Oligo 1; Oligo1; Oligodendrocyte lineage transcription factor 1; Oligodendrocyte specific bHLH transcription factor 1; Oligodendrocyte transcription factor 1
Species
Homo sapiens (Human)
Source
Yeast
Expression Region
17-105aa
Target Protein Sequence
MLRPQRPGDLQLGASLYELVGYRQPPSSSSSSTSSTSSTSSSSTTAPLLPKAAREKPEAPAEPPGPGPGSGAHPGGSARPDAKEEQQQQ
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
11.1 kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Promotes formation and maturation of oligodendrocytes, especially within the brain. Cooperates with OLIG2 to establish the pMN domain of the embryonic neural tube.
Gene References into Functions
  1. Olig1 has a critical function in regulation of postnatal neural progenitor cell production in response to Noggin. PMID: 28253550
  2. This study demonstrated that increased expression of mRNA of OLIG1 in ventral prefrontal white matter in major depressive disorder. PMID: 25930075
  3. Olig1 is a Smad cofactor involved in TGF-beta-induced cell motility PMID: 23720758
  4. This study review OLIG1 have developmental functions in patterning, neuron subtype specification and the formation of oligodendrocytes and play the role in the postnatal brain during repair processes and in neurological disease states. PMID: 23165259
  5. Olig1 was not expressed in freshly isolated oligodendrocytes, but is expressed from the beginning of process extension until membrane maintenance. PMID: 21446039
  6. analysis of conserved and non-conserved functional elements at the Olig1 and Olig2 locus PMID: 21206754
  7. Olig1 and Olig2 transcription factors in the human central nervous system are important not only for differentiation of the oligodendrocyte lineage, but they may also have a role in neural cell specification. PMID: 16267213
  8. identified novel coding variants in the Olig1 gene, including a trinucleotide repeat, but found no evidence to support the hypothesis that genetic variation in Olig1 influences susceptibility to multiple sclerosis PMID: 16820418
  9. Mutations in OLIG1 and OLIG2 are not likely to be associated with this subgroup of hypomyelinating disorders. PMID: 17171653
  10. OLIG1 protein expression significantly correlates with overall survival in non-small cell lung cancer patients PMID: 17388669
  11. No significan correlation was found between proliferation index in pilocytic astrocytomas and Olig-1 expression. PMID: 17690840

Show More

Hide All

Subcellular Location
Nucleus.
Tissue Specificity
Expressed in the brain, in oligodendrocytes. Strongly expressed in oligodendrogliomas, while expression is weak to moderate in astrocytomas. Expression in glioblastomas is highly variable.
Database Links

HGNC: 16983

OMIM: 606385

KEGG: hsa:116448

STRING: 9606.ENSP00000371785

UniGene: Hs.56663

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*