Recombinant Human Oxytocin-neurophysin 1 (OXT), partial

In Stock
Code CSB-EP017315HUb3
Abbreviation Recombinant Human OXT protein, partial
MSDS
Size US$256
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP017315HUb3 could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) OXT.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP017315HUb3 could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) OXT.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Alternative Names
OXT; OT; Oxytocin-neurophysin 1; OT-NPI) [Cleaved into: Oxytocin; Ocytocin); Neurophysin 1]
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
32-125aa
Target Protein Sequence
AAPDLDVRKCLPCGPGGKGRCFGPNICCAEELGCFVGTAEALRCQEENYLPSPCQSGQKACGSGGRCAVLGLCCSPDGCHADPACDAEATFSQR
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
29.6kDa
Protein Length
Partial
Tag Info
N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews
Average Rating:
5.0 - 1 reviews

Submit a Review here

Applications : Western blot

Review: HT-29 cells were pre_x005ftreated with OXT (10-8 M) for 1 h and then stimulated with LPS (100 ng/ml). The protein expression of β-arrestin2 in HT-29 cells was measured by western blotting.

By Anonymous

Target Background

Function
Neurophysin 1 specifically binds oxytocin.; Oxytocin causes contraction of the smooth muscle of the uterus and of the mammary gland. Acts by binding to oxytocin receptor (OXTR).
Gene References into Functions
  1. The results suggest that there is an age-dependent association between visual attention for social cues and oxytocin (OT) levels in infants and children, and that the development of visual attention to the eyes as social cues is associated with both OXTR polymorphisms and OT levels. PMID: 28566712
  2. Although some SNPs were associated at an alpha level of .05 with breastfeeding, they did not survive multiple testing correction. Authors conclude that SNPs within or nearby OXT and OXTR are unlikely to have large effects on breastfeeding behavior. PMID: 29412506
  3. Oxytocin gene polymorphisms and parenting G x E interaction on social anxiety levels in adolescents. PMID: 28606214
  4. serum oxytocin levels were higher among women than men and were negatively associated with strength of belief in life after death PMID: 26898770
  5. A significant moderating effect of OXT genotype (rs2740210) on the relationship between social support and psychiatric distress was detected PMID: 29040351
  6. findings suggested more significant plasma oxytocin dysregulation in the patients in the bipolar II disorder group than in the major depressive disorder patients and controls, both before and after treatment PMID: 28865715
  7. Oxytocin level did not vary significantly between healthy controls, healthy controls with a history of sexual abuse, and psychogenic non-epileptic seizure patients with a history of sexual abuse. PMID: 28927333
  8. These results suggest that OXT and OXTR are controlled mainly by E2 in the placenta via ESR1 and thus may play physiological functions in the human placenta during the late stage of pregnancy. PMID: 28694300
  9. Study found a higher expression of paraventricular nucleus OXT in the mood disorder patients than in the control subjects, and observed a clear co-localization of androgen receptor in OXT-expressing neurons, both in the cytoplasm and in the nucleus. In addition, a significant decrease in OXT-mRNA levels was observed after pre-incubation of the SK-N-SH cells with testosterone. PMID: 28447621
  10. Serum and prostatic oxytocin levels are increased in the PCa subjects. Serum oxytocin level may be a biomarker for PCa in the future. Oxytocin increases PCa growth and APPL1 expression. PMID: 28415720
  11. Obese children had significantly higher irisin and lower oxytocin levels than the healthy controls. PMID: 28077341
  12. study found that rs6133010 in the OXT gene is associated with alcohol dependence in the northern Chinese Han population PMID: 27818356
  13. OXT levels were lowest in anorexia nervosa, higher in healthy controls, and highest in obesity. There were positive associations between OXT and body mass index, total, visceral, and subcutaneous fat, and bone mineral density. PMID: 28586943
  14. epigenetic modification of OXT is linked to several overt measures of sociability PMID: 27325757
  15. Hormonal changes in estradiol, progesterone, or oxytocin do not predict differences in the pain perception of women in the peripartum or postpartum period. PMID: 27028773
  16. Oxytocin prevents cartilage matrix destruction via regulating MMP1 and MMP13. PMID: 28238786
  17. Low oxytocin expression is associated with diabetic metabolic syndrome. PMID: 27578619
  18. Oxytocin levels were lower in autistic patients compared to controls. PMID: 26739971
  19. Children with Prader-Willi syndrome have elevated plasma oxytocin levels. PMID: 26615966
  20. This is the first known study to show a significant association between callous unemotional traits in children and adolescents with extreme, persistent pervasive aggression and a polymorphism on the oxytocin receptor. PMID: 22294460
  21. Oxytocin serum levels with Attention Deficit Hyperactivity Disorder were significantly decreased compared with controls. PMID: 26168929
  22. reviews the role of OT in the control mechanisms of sexual behavior. PMID: 25088178
  23. Oxytocin activates NF-kappaB-mediated inflammatory pathways in human gestational tissues in normal parturition. PMID: 25451977
  24. Report for the first time of a significant genetic association of OXT and AVP with schizophrenia PMID: 21899794
  25. nominal associations were found between autism spectrum disorder scores and single-nucleotide polymorphisms in OXT, ARNT2 and CD38 PMID: 24635660
  26. findings suggest that experiences of childhood emotional maltreatment may alter salivary oxytocin levels, which in turn are related to more positive perceptions of infant stimuli with positive emotion PMID: 24768649
  27. Patients with poor outcome after aneurysmal subarachnoid hemorrhage have lower AVP and OXT levels in cerebrospinal fluid. PMID: 24412107
  28. dysregulation of OXT, AVP and/or testosterone systems exist in mothers of autistic children. PMID: 24086383
  29. OXT rs2740210 interacted with early life adversity to predict variation in breastfeeding duration and postpartum depression. PMID: 23941164
  30. Women with low OT may not effectively interpret and utilize available support resources, which may be associated with sleep disturbances PMID: 23799864
  31. Oxytocin plays an important role in modulation of social bonding processes and stress regulation, and may be crucially involved in the promotion of mental health. Review. PMID: 23856187
  32. Data from women undergoing hysterectomy for uterine fibroids suggest that uterine isthmian-cervical myoma pseudocapsules exhibit substantial nerve fibers expressing OXT; uterine fundal myoma pseudocapsules exhibit few nerve fibers expressing OXT. PMID: 23937196
  33. Data suggest that that OXT enhances pro-social behavior by influencing complex brain networks involved in self-referential processing and affectionate touch, most prominently in individuals with supportive family experiences in childhood. PMID: 23453164
  34. findings suggest that oxytocin might not promote human bond formation in ways analogous to prairie voles - that is, by inducing a partner preference effect PMID: 22920910
  35. OT increases covert attention to happy faces, thereby supporting the hypothesis that OT modulates early attentional processes that might promote prosocial behavior in healthy men. PMID: 23146328
  36. In couples, relationship quality had a small, marginally significant inverse association with plasma oxytocin levels. PMID: 22543270
  37. polymorphisms in OXT associate with both infant-directed vocalizing and maternal instrumental care. PMID: 23637833
  38. Results indicate that oxytocin, beyond its role in social bonding, regulates non-homeostatic, reward-related energy intake, hypothalamic-pituitary-adrenal axis activity, and the glucoregulatory response to food intake in humans. PMID: 23835346
  39. OT inhibits neuroadaptation to and withdrawal from alcohol. PMID: 23025690
  40. OT is a regulator of the PI3K/Akt/mTORC1 pathway in Caco2BB cells and may modulate translation in gut cells. PMID: 23410756
  41. kisspeptin-10 transiently excites oxytocin neurons in late pregnancy and during lactation, suggesting that a central kisspeptin excitation of oxytocin neurons emerges at the end of pregnancy PMID: 23550008
  42. Women who perceived low cognitive social capital showed higher oxytocin levels, while structural social capital showed inverse-U shape association with oxytocin. No association between oxytocin and social capital was found among men. PMID: 23284856
  43. oxytocin and argipressin have been referred to as "social" neuropeptides as they have a highly conserved role as mediators of complex social cognition and interaction in both animals and humans PMID: 23589638
  44. The study links defense-motivated competition to oxytocin, a hypothalamic neuropeptide involved in reproduction and social bonding. PMID: 23144787
  45. Results show low plasma oxytocin levels in patients with generalized social anxiety disorder compared to controls during a prosocial laboratory task paradigm. PMID: 22807189
  46. Data suggest that nocturnal oxytocin secretion is low in amenorrheic athletes compared with nonathletes and is associated with site-dependent microarchitectural parameters of bone (tibia [weight-bearing]; radius [non-weight-bearing]). PMID: 23258269
  47. [review] The OT system functions as an important element within a complex, developmentally sensitive biobehavioral system. PMID: 21984889
  48. Data suggest that plasma oxytocin is lower in subjects with uncontrolled type 2 diabetes along with psychoticism, somatization, or obsessionality as compared with subjects with controlled type 2 diabetes. PMID: 22997507
  49. first evidence or relationship between plasma oxytocin level and expression of SERT (serotonin transporter) on platelet membranes PMID: 22297159
  50. Oxytocin may be involved in the pathophysiology of anorexia. PMID: 22872688

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
Vasopressin/oxytocin family
Database Links

HGNC: 8528

OMIM: 167050

KEGG: hsa:5020

STRING: 9606.ENSP00000217386

UniGene: Hs.113216

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*