Recombinant Human Oxytocin-neurophysin 1(OXT),partial

In Stock
Code CSB-EP017315HU
Product Type Recombinant Protein
Size US$2062Purchase it in Cusabio online store
(Shop online in the US. Customers outside the US,
please order from local distributors.)
Uniprot No. P01178
Lead Time 3-7 business days
Relevance Neurophysin 1 specifically binds oxytocin.Oxytocin causes contraction of the smooth muscle of the uterus and of the mammary gland.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Purity Greater than 85% as determined by SDS-PAGE.
Sequence AAPDLDVRKCLPCGPGGKGRCFGPNICCAEELGCFVGTAEALRCQEENYLPSPCQSGQKACGSGGRCAVLGLCCSPDGCHADPACDAEATFSQR
Source E.coli
Gene Names OXT
Protein Names Ocytocin
Expression Region 32-125aa
Tag Info N-terminal 10xHis-tagged and C-terminal Myc-tagged
Mol. Weight 14.6kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Neurophysin 1 specifically binds oxytocin.; FUNCTION
Subcellular Location Secreted
Protein Families Vasopressin/oxytocin family
Database Links

HGNC: 8528

OMIM: 167050

KEGG: hsa:5020

STRING: 9606.ENSP00000217386

UniGene: Hs.113216

Related Products

OXT Antibodies

OXT Antibodies for Homo sapiens (Human)

OXT Antibodies for Human

OXT Proteins

OXT Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.