Recombinant Human Peroxisome proliferator-activated receptor gamma (PPARG)

Code CSB-BP018424HU
Size Pls inquire
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP018424HU-B
Size Pls inquire
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-MP018424HU
Size Pls inquire
Source Mammalian cell
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
>85% (SDS-PAGE)
Target Names
PPARG
Uniprot No.
Alternative Names
CIMT1; GLM1; NR1C3; Nuclear receptor subfamily 1 group C member 3; OTTHUMP00000185032; OTTHUMP00000185036; Peroxisome proliferator activated nuclear receptor gamma variant 1; Peroxisome proliferator activated receptor gamma 1; Peroxisome Proliferator Activated Receptor gamma; Peroxisome proliferator-activated receptor gamma; PPAR gamma; PPAR-gamma; PPARG; PPARG_HUMAN; PPARG1; PPARG2; PPARgamma
Species
Homo sapiens (Human)
Expression Region
1-477
Target Protein Sequence
MTMVDTEMPFWPTNFGISSVDLSVMEDHSHSFDIKPFTTVDFSSISTPHYEDIPFTRTDP VVADYKYDLKLQEYQSAIKVEPASPPYYSEKTQLYNKPHEEPSNSLMAIECRVCGDKASG FHYGVHACEGCKGFFRRTIRLKLIYDRCDLNCRIHKKSRNKCQYCRFQKCLAVGMSHNAI RFGRMPQAEKEKLLAEISSDIDQLNPESADLRALAKHLYDSYIKSFPLTKAKARAILTGK TTDKSPFVIYDMNSLMMGEDKIKFKHITPLQEQSKEVAIRIFQGCQFRSVEAVQEITEYA KSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPF GDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQ LKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDLY
Protein Length
The full length of isoform 1(identifier: P37231-2)
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Nuclear receptor that binds peroxisome proliferators such as hypolipidemic drugs and fatty acids. Once activated by a ligand, the nuclear receptor binds to DNA specific PPAR response elements (PPRE) and modulates the transcription of its target genes, such as acyl-CoA oxidase. It therefore controls the peroxisomal beta-oxidation pathway of fatty acids. Key regulator of adipocyte differentiation and glucose homeostasis. ARF6 acts as a key regulator of the tissue-specific adipocyte P2 (aP2) enhancer. Acts as a critical regulator of gut homeostasis by suppressing NF-kappa-B-mediated proinflammatory responses. Plays a role in the regulation of cardiovascular circadian rhythms by regulating the transcription of ARNTL/BMAL1 in the blood vessels.; (Microbial infection) Upon treatment with M.tuberculosis or its lipoprotein LpqH, phosphorylation of MAPK p38 and IL-6 production are modulated, probably via this protein.
Gene References into Functions
  1. LEPR rs1137101 and PPARG-2 rs1801282 had weak and medium negative effects on zBMI, respectively, and may slightly protect against childhood obesity. PMID: 29679223
  2. Data show the partial-agonist-bound PPARgamma is characterized by multiple thermodynamically accessible conformations. PMID: 29728618
  3. Cellular metabolism constrains innate immune responses in preterm infants due to perturbations in the expression of PPARgamma, MALT1, DDIT4, and most of the cytokines. PMID: 30446641
  4. PPARgamma knockdown resulted in increased levels of TOMM40, APOE and APOC1 -mRNAs, showing the strongest impact on APOE transcript levels. PMID: 28065845
  5. Studies indicate that peroxisome proliferator activated receptor gamma (PPARgamma) expression is found in different regions of the kidney and, upon activation, can redirect metabolism [Review]. PMID: 30012954
  6. These results demonstrate that betaine acts through ERK1/2-PPARgamma signalling pathway to regulate lipid metabolism in adipogenic-differentiated skeletal muscle cells, which could provide some useful information for controlling muscle lipid accumulation by manipulating ERK1/2 and PPARgamma signalling pathway. PMID: 29383561
  7. novel soluble form present in maternal plasma, umbilical plasma, and amniotic fluid, elevated in gestational diabetes mellitus maternal individuals, and correlated with the lipid uptake of trophoblast cells PMID: 28720051
  8. ALDH1A3 suppression could be one of PPARG tumor suppressive function. This study provides a better understanding of the role of PPARG in lung cancer. PMID: 29873276
  9. Regulation of transmembrane-4-L-six-family-1 (TM4SF1) on bladder cancer cell could be induced by peroxisome proliferator-activated receptor gamma (PPARgamma)-sirtuin 1 (SIRT1) feedback loop. PMID: 29175458
  10. Peroxisome proliferators-activated receptor gamma polymorphism is associated with the risk of colorectal cancer. PMID: 29970681
  11. The lack of PPARγ in recurrent miscarriage decidual macrophages seems to be associated with a specific inflammatory response against the fetus. PMID: 29949879
  12. EDF1 is required for VEGF-induced activation of the transcriptional activity of PPARgamma in HUVEC cells. PMID: 29933613
  13. Studied peroxisome proliferator-activated receptor-gamma gene (PPARgamma) single nucleotide polymorphisms (SNPs); found the SNPs to be associated with the occurrence or progression of sepsis. PMID: 29055064
  14. This study suggests that T2D patients with different genotypes at CD36, NOS3 and PPARG respond differentially to intervention of omega-3 supplements in blood lipid profiles. PMID: 29703528
  15. ITLN1, PPARg AND TNFa GENE EXPRESSION IN VISCERAL ADIPOSE TISSUE. PMID: 30188100
  16. Gene expressions of YKL-40 and CD36 were significantly higher in patients with T2DM (>5 yr) with hypertension compared to healthy controls (P=0.006). In addition, a significant increase in serum levels of sCD36, PPAR-gamma and YKL-40 was observed in patients with T2DM (>5 yr) with hypertension compared to healthy controls PMID: 29806605
  17. Mechanistic investigation revealed a miR-301b~miR-130b-PPARgamma axis, whose expression pattern in umbilical cord (UC), adipose tissue (Ad) and bone marrow mesenchymal stem cells significantly correlates with their adipogenic capacity. PMID: 28442776
  18. The negative responders for aerobic training are subjects with the PPARG rs1801282 Pro/Pro genotype. The best responders to aerobic training are PPARG rs1801282 Ala carriers. PMID: 29762540
  19. These results demonstrated the association of PPARgamma Pro allele with susceptibility to acne vulgaris. PMID: 29120856
  20. participation rates in the genotype-based recall study were 31%, 44%, and 40%, and accordingly we included 12, 15, and 13 individuals with Pro12Pro, Pro12Ala, and Ala12Ala variants of PPARG, respectively PMID: 29303622
  21. Here we have shown for the first time, that ligand- or insulin-mediated activation of PPARgamma in human hepatoma cell line HepG2 causes the downregulation of C3 gene expression and protein secretion PMID: 29550264
  22. Interactions between SOD2 and PPAR-gamma SNPs regarding mortality influence were detected in diabetic ESRD patients. PMID: 27925431
  23. Data suggest that up-regulation of NPY inhibits proliferation of adipose-derived stem cells while promoting adipogenesis and up-regulating expression of white adipocyte biomarkers PPARG, CEBPA, CIDEC, and RIP140. (NPY = neuropeptide Y; CEBPA = CCAAT/enhancer-binding protein alpha; CIDEC = cell death-inducing DFFA-like effector C; RIP140 = nuclear receptor interacting protein 1) PMID: 28954935
  24. The presence of Pro12Pro and C14131C genotypes is related to higher TAG level in CTD. PMID: 29606859
  25. Low PPARG expression is associated with childhood obesity. PMID: 28733963
  26. The results propose that PPARgamma may act as a master regulator of the transcription of several genes involved in late-onset Alzheimer's disease pathogenesis. PMID: 29723294
  27. Polymorphism of PPARG is associated with late onset of type 2 diabetes mellitus. PMID: 28292576
  28. PPARgamma gene rs2921190 polymorphism was correlated with the susceptibility to northwest dryness syndrome. PMID: 29960292
  29. Phosphorylation of S273 of PPARgamma occurs in cancer cells on exposure to DNA damaging agents. PMID: 29295932
  30. Chinese Han persons with C allele of rs3856806 in PPARG gene were significantly associated with the decreased risk of hypertension. PMID: 29266977
  31. We further identified this underlying mechanism also involved a PPARgamma-induced ANXA1-dependent autoubiquitination of cIAP1, the direct E3 ligase of RIP1, shifting cIAP1 toward proteosomal degradation..our study provides first insight for the suitability of using drug-induced expression of ANXA1 as a new player in RIP1-induced death machinery in triple-negative breast cancer PMID: 29021293
  32. PAX8-PPARG fusions may not play major roles in the tumorigenesis of paediatric follicular thyroid carcinoma PMID: 28621837
  33. Quantitative polymerase chain reaction, immunohistochemistry, Western blotting, and microarray analysis showed enrichment of adipogenic mediators (C/EBP family P = .027; KLF5 P < .000; and peroxisome proliferator activated receptor-gamma, P = .032) in AAA tissue. PMID: 28912007
  34. the mRNA expression levels of PPARG were not significantly different between the tumor tissues and tissue margins PMID: 28504924
  35. These results suggest that the inhibited brain development seen in humans exposed to the stress of a premature extrauterine environment is modulated by genetic factors, and that PPARG signaling has a previously unrecognized role in cerebral development. PMID: 29229843
  36. PPAR-gamma and Akt regulate GLUT1 and GLUT3 surface localization during Mycobacterium tuberculosis infection. PMID: 28852964
  37. Here, the authors characterize mutant RXRA, demonstrating it induces enhancer/promoter activity in the context of RXRA/PPAR heterodimers in human bladder cancer cells. PMID: 29143738
  38. Low PPARG expression is associated with Gemcitabine Resistance in Cholangiocarcinoma. PMID: 28560603
  39. PPARG gene polymorphism causes the development of oxidative stress in patients with type 2 diabetes with 5-10 years durations. PMID: 29762970
  40. co-expression of PPARgamma and TRAP220 represents a biomarker for good prognosis in colorectal cancer patients PMID: 26130665
  41. Carriers of the PPAR-gamma Ala12 allele showed greater cognitive decline compared to non-carriers but the risk varied across sex and ethnic groups. Male Ala12 carriers of Hispanic origin may be a high-risk group for cognitive decline. PMID: 28181642
  42. overexpression of GATA3 and FOXA1 cooperate with PPAR activation to drive transdifferentiation of a basal bladder cancer cells to a luminial phenotype. PMID: 27924948
  43. Results show that the nuclear distribution of PPARgamma in gastric cancer (GC) tissues and cell lines was markedly decreased. Its expression is regulated by miR-133b in gastric neoplasm tissue and cell lines. PMID: 28901466
  44. study implies that DJ-1 may protect endothelial progenitor cells against Ang II-induced dysfunction by activating the PPARgamma/HO-1. PMID: 28600848
  45. There were no differences between the distribution of genotypes and the allele frequencies of the PPARG Pro12Ala, and C1431T polymorphisms and the ADRB3 Trp64Arg polymorphism in normo- and hyperglycaemic women. PMID: 29464546
  46. We conclude that rs1784933 and rs1805192 minor alleles, gene- gene interaction between rs1784933 and rs1805192, gene- environment interaction between rs1784933 and alcohol drinking, and haplotype containing the rs1784933- A and rs689021- C alleles are all associated with increased LOAD risk. PMID: 28427149
  47. Most of the tested flavonoids, but not the antioxidant vitamins, stimulated Nrf2-, FoxO-, and PPARgamma-dependent promoter activities. PMID: 28761622
  48. Findings suggest that despite their proposed involvement in the regulation of inflammatory processes in multiple sclerosis (MS), PPARalpha, PPARbeta/delta, and PGC-1alpha proteins are not potential biomarkers of neuroinflammation in MS, and indicate a preferential role of PPARgamma in the endogenous regulation of autoimmune response in the human central nervous system within its receptor family. PMID: 28483651
  49. combined administration of small-interfering RNA (siRNA) transfection with PPARgamma ligands induced downregulation of SOX2 and MMP2 activity together with inhibition of sphere-forming activity regardless of poly(ADP-ribose) polymerase (PARP) cleavage. Taken together, our findings suggest that a combination therapy using PPARgamma ligands and its inhibitor could be a potential therapeutic strategy targeting glioblastom... PMID: 28642874
  50. Results showed that polymorphism in PPARGrs10865710, PPARGrs1805192 and CYP1A1rs4646903 and interaction between PPARGrs1805192 and CYP1A1rs4646903 were related with increased coronary artery disease susceptibility. PMID: 28415751

Show More

Hide All

Involvement in disease
Obesity (OBESITY); Lipodystrophy, familial partial, 3 (FPLD3); Glioma 1 (GLM1)
Subcellular Location
Nucleus. Cytoplasm. Note=Redistributed from the nucleus to the cytosol through a MAP2K1/MEK1-dependent manner. NOCT enhances its nuclear translocation.
Protein Families
Nuclear hormone receptor family, NR1 subfamily
Tissue Specificity
Highest expression in adipose tissue. Lower in skeletal muscle, spleen, heart and liver. Also detectable in placenta, lung and ovary.
Database Links

HGNC: 9236

OMIM: 137800

KEGG: hsa:5468

STRING: 9606.ENSP00000287820

UniGene: Hs.162646

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
webinars: DT3C facilitates antibody internalization X