Purity
Greater than 90% as determined by SDS-PAGE.
Alternative Names
GCTM-2 antigen; Gp2; Gp200; MGC138240; PC; PCLP; PCLP-1; PCLP1; Pcx; Podocalyxin; Podocalyxin like; Podocalyxin like protein; Podocalyxin-like protein 1; Podxl; PODXL_HUMAN
Species
Homo sapiens (Human)
Expression Region
32-458aa
Target Protein Sequence
QNATQTTTDSSNKTAPTPASSVTIMATDTAQQSTVPTSKANEILASVKATTLGVSSDSPGTTTLAQQVSGPVNTTVARGGGSGNPTTTIESPKSTKSADTTTVATSTATAKPNTTSSQNGAEDTTNSGGKSSHSVTTDLTSTKAEHLTTPHPTSPLSPRQPTSTHPVATPTSSGHDHLMKISSSSSTVAIPGYTFTSPGMTTTLLETVFHHVSQAGLELLTSGDLPTLASQSAGITASSVISQRTQQTSSQMPASSTAPSSQETVQPTSPATALRTPTLPETMSSSPTAASTTHRYPKTPSPTVAHESNWAKCEDLETQTQSEKQLVLNLTGNTLCAGGASDEKLISLICRAVKATFNPAQDKCGIRLASVPGSQTVVVKEITIHTKLPAKDVYERLKDKWDELKEAGVSDMKLGDQGPPEEAEDRF
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The recombinant Human PODXL was expressed with the amino acid range of 32-458. The calculated molecular weight for this PODXL protein is 48.2 kDa. The PODXL protein was expressed in e.coli. Fusion of the N-terminal 6xHis tag into the PODXL encoding gene fragment was conducted, allowing for easier detection and purification of the PODXL protein in subsequent stages.
Human podocalyxin (PODXL) is a transmembrane glycoprotein that is mainly expressed in kidney podocytes, vascular endothelia, and hematopoietic cells. It is involved in various physiological processes, including cell adhesion, migration, and signaling. Its extracellular domain is implicated in interactions with other proteins, influencing cell morphology. In cancer research, PODXL is associated with tumor progression and metastasis. Understanding the functions of PODXL provides insights into developmental biology, kidney physiology, and cancer pathology.
