Recombinant human Poly [ADP-ribose] polymerase 11(PARP11), partial

In Stock
Code CSB-EP017459HU
Abbreviation Recombinant Human PARP11 protein, partial
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Epigenetics and Nuclear Signaling
Alternative Names
ADP ribosyltransferase (NAD+; poly (ADP ribose) polymerase); ADP ribosyltransferase; ADP ribosyltransferase diphtheria toxin like 1; ADP ribosyltransferase NAD(+); ADPRT 1; ADPRT; ADPRT1; ARTD1; msPARP; NAD(+) ADP ribosyltransferase 1; NAD(+) ADP-ribosyltransferase 1; pADPRT 1; pADPRT-1; pADPRT1; PARP 1; PARP; PARP-1; PARP1; PARP1_HUMAN; Poly (ADP ribose) polymerase 1; poly (ADP ribose) polymerase family; member 1; Poly (ADP-ribose) polymerase 1; Poly [ADP-ribose] polymerase 1; Poly(ADP ribose) polymerase; poly(ADP ribose) synthetase; poly(ADP ribosyl)transferase; Poly(ADP-ribosyl)transferase; Poly[ADP ribose] synthetase 1; Poly[ADP-ribose] synthase 1; PPOL; sPARP 1; sPARP1
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
9-338aa
Target Protein Sequence
FHKAEELFSKTTNNEVDDMDTSDTQWGWFYLAECGKWHMFQPDTNSQCSVSSEDIEKSFKTNPCGSISFTTSKFSYKIDFAEMKQMNLTTGKQRLIKRAPFSISAFSYICENEAIPMPPHWENVNTQVPYQLIPLHNQTHEYNEVANLFGKTMDRNRIKRIQRIQNLDLWEFFCRKKAQLKKKRGVPQINEQMLFHGTSSEFVEAICIHNFDWRINGIHGAVFGKGTYFARDAAYSSRFCKDDIKHGNTFQIHGVSLQQRHLFRTYKSMFLARVLIGDYINGDSKYMRPPSKDGSYVNLYDSCVDDTWNPKIFVVFDANQIYPEYLIDFH
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
41.0kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The expression region of this recombinant Human PARP11 covers amino acids 9-338. The theoretical molecular weight of the PARP11 protein is 41 kDa. The PARP11 protein was expressed in e.coli. The PARP11 coding gene included the N-terminal 6xHis tag, which simplifies the detection and purification processes of the recombinant PARP11 protein in following stages of expression and purification.

Poly [ADP-ribose] polymerase 11 (PARP11) is a member of the PARP family, which is involved in the regulation of various cellular processes, including DNA repair, genomic stability, and cell death. PARP enzymes catalyze the addition of ADP-ribose polymers to target proteins, a process known as poly(ADP-ribosyl)ation. PARP11, specifically, has been implicated in the regulation of immune responses. It is known to interact with components of the innate immune system and may play a role in modulating antiviral responses. Additionally, PARP11 has been associated with the endoplasmic reticulum-associated degradation (ERAD) pathway, suggesting a potential role in protein quality control. Research on PARP11 extends to understanding its precise molecular functions, its involvement in cellular processes beyond the immune response, and its potential implications in diseases.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Mono-ADP-ribosyltransferase that mediates mono-ADP-ribosylation of target proteins. Plays a role in nuclear envelope stability and nuclear remodeling during spermiogenesis.
Subcellular Location
Nucleus, nuclear pore complex.
Database Links

HGNC: 1186

OMIM: 616706

KEGG: hsa:57097

STRING: 9606.ENSP00000228820

UniGene: Hs.657268

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*