Purity
Greater than 90% as determined by SDS-PAGE.
Research Area
Epigenetics and Nuclear Signaling
Alternative Names
ADP ribosyltransferase (NAD+; poly (ADP ribose) polymerase); ADP ribosyltransferase; ADP ribosyltransferase diphtheria toxin like 1; ADP ribosyltransferase NAD(+); ADPRT 1; ADPRT; ADPRT1; ARTD1; msPARP; NAD(+) ADP ribosyltransferase 1; NAD(+) ADP-ribosyltransferase 1; pADPRT 1; pADPRT-1; pADPRT1; PARP 1; PARP; PARP-1; PARP1; PARP1_HUMAN; Poly (ADP ribose) polymerase 1; poly (ADP ribose) polymerase family; member 1; Poly (ADP-ribose) polymerase 1; Poly [ADP-ribose] polymerase 1; Poly(ADP ribose) polymerase; poly(ADP ribose) synthetase; poly(ADP ribosyl)transferase; Poly(ADP-ribosyl)transferase; Poly[ADP ribose] synthetase 1; Poly[ADP-ribose] synthase 1; PPOL; sPARP 1; sPARP1
Species
Homo sapiens (Human)
Expression Region
9-338aa
Target Protein Sequence
FHKAEELFSKTTNNEVDDMDTSDTQWGWFYLAECGKWHMFQPDTNSQCSVSSEDIEKSFKTNPCGSISFTTSKFSYKIDFAEMKQMNLTTGKQRLIKRAPFSISAFSYICENEAIPMPPHWENVNTQVPYQLIPLHNQTHEYNEVANLFGKTMDRNRIKRIQRIQNLDLWEFFCRKKAQLKKKRGVPQINEQMLFHGTSSEFVEAICIHNFDWRINGIHGAVFGKGTYFARDAAYSSRFCKDDIKHGNTFQIHGVSLQQRHLFRTYKSMFLARVLIGDYINGDSKYMRPPSKDGSYVNLYDSCVDDTWNPKIFVVFDANQIYPEYLIDFH
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The expression region of this recombinant Human PARP11 covers amino acids 9-338. The theoretical molecular weight of the PARP11 protein is 41 kDa. The PARP11 protein was expressed in e.coli. The PARP11 coding gene included the N-terminal 6xHis tag, which simplifies the detection and purification processes of the recombinant PARP11 protein in following stages of expression and purification.
Poly [ADP-ribose] polymerase 11 (PARP11) is a member of the PARP family, which is involved in the regulation of various cellular processes, including DNA repair, genomic stability, and cell death. PARP enzymes catalyze the addition of ADP-ribose polymers to target proteins, a process known as poly(ADP-ribosyl)ation. PARP11, specifically, has been implicated in the regulation of immune responses. It is known to interact with components of the innate immune system and may play a role in modulating antiviral responses. Additionally, PARP11 has been associated with the endoplasmic reticulum-associated degradation (ERAD) pathway, suggesting a potential role in protein quality control. Research on PARP11 extends to understanding its precise molecular functions, its involvement in cellular processes beyond the immune response, and its potential implications in diseases.