Recombinant Human Probable global transcription activator SNF2L2 (SMARCA2), partial

In Stock
Code CSB-EP021799HU1
Abbreviation Recombinant Human SMARCA2 protein, partial
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 95% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Epigenetics and Nuclear Signaling
Alternative Names
ATP-dependent helicase SMARCA2;BRG1-associated factor 190B;BAF190B;Protein brahma homolog;hBRM;SNF2-alpha;SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 2
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1350-1520aa
Target Protein Sequence
RNVDKDPAKEDVEKAKKRRGRPPAEKLSPNPPKLTKQMNAIIDTVINYKDRCNVEKVPSNSQLEIEGNSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLGDLEKDVMLLCHNAQTFNLEGSQIYEDSIVLQSVFKSARQKIAKEEESEDESNEEE
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
26.8 kDa
Protein Length
Partial
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Involved in transcriptional activation and repression of select genes by chromatin remodeling (alteration of DNA-nucleosome topology). Component of SWI/SNF chromatin remodeling complexes that carry out key enzymatic activities, changing chromatin structure by altering DNA-histone contacts within a nucleosome in an ATP-dependent manner. Binds DNA non-specifically. Belongs to the neural progenitors-specific chromatin remodeling complex (npBAF complex) and the neuron-specific chromatin remodeling complex (nBAF complex). During neural development a switch from a stem/progenitor to a postmitotic chromatin remodeling mechanism occurs as neurons exit the cell cycle and become committed to their adult state. The transition from proliferating neural stem/progenitor cells to postmitotic neurons requires a switch in subunit composition of the npBAF and nBAF complexes. As neural progenitors exit mitosis and differentiate into neurons, npBAF complexes which contain ACTL6A/BAF53A and PHF10/BAF45A, are exchanged for homologous alternative ACTL6B/BAF53B and DPF1/BAF45B or DPF3/BAF45C subunits in neuron-specific complexes (nBAF). The npBAF complex is essential for the self-renewal/proliferative capacity of the multipotent neural stem cells. The nBAF complex along with CREST plays a role regulating the activity of genes essential for dendrite growth.
Gene References into Functions
  1. association of the BRG1/hBRM bromodomain with nucleosomes plays a regulatory rather than targeting role PMID: 28706277
  2. High expression of SMARCA2 is associated with benign differentiated tumors. PMID: 29391527
  3. Here, the authors show that C-terminally truncated forms of both SMARCA2 and SMARCA4, produced by caspase-mediated cleavage, accumulate in cells infected with different RNA or DNA viruses. The levels of truncated SMARCA2 or SMARCA4 strongly correlate with the degree of cell damage and death observed after virus infection. PMID: 29848589
  4. at genes where BRG1 and BRM antagonize one another we observe a nearly complete rescue of gene expression changes in the combined BRG/BRM double knockdown PMID: 29273066
  5. Expression of BRM and MMP2 in the thoracic aortic aneurysm and aortic dissection is very high, indicating that BRM and MMP2 may play important roles in the occurrence and development of thoracic aortic aneurysm and aortic dissection. PMID: 28678310
  6. Although Genome-Wide Association studies have not been carried out in the field of alcohol-related hepatocellular carcinoma (HCC), common single nucleotide polymorphisms conferring a small increase in the risk of liver cancer risk have been identified. Specific patterns of gene mutations including CTNNB1, TERT, ARID1A and SMARCA2 exist in alcohol-related HCC. [review] PMID: 28296015
  7. PRC2-mediated repression of SMARCA2 predicts EZH2 inhibitor activity in SWI/SNF mutant tumors. PMID: 29087303
  8. two promoter BRM germline variants were associated with worse outcome in our esophageal adenocarcinoma (EAC) patients. This significantly poorer outcome was independent of TNM classification at diagnosis or other clinic-demographic variables. PMID: 28427211
  9. Epigenetic regulatory molecules bind to two BRM promoter sequence variants but not to their wild-type sequences. These variants are associated with adverse overall and progression-free survival. Decreased BRM gene expression, seen with these variants, is also associated with worse overall survival PMID: 27827316
  10. We also demonstrate that tazemetostat, a potent and selective EZH2 inhibitor currently in phase II clinical trials, induces potent antiproliferative and antitumor effects in SCCOHT cell lines and xenografts deficient in both SMARCA2 and SMARCA4. These results exemplify an additional class of rhabdoid-like tumors that are dependent on EZH2 activity for survival. PMID: 28292935
  11. Two BRM promoter polymorphisms were strongly associated with hepatocellular carcinoma (HCC) prognosis but were not associated with increased HCC susceptibility. PMID: 28892201
  12. This de novo SMARCA2 missense mutation c.3721C>G, p.Gln1241Glu is the only reported mutation on exon 26 outside the ATPase domain of SMARCA2 to be associated with Nicolaides-Baraitser syndrome and adds to chromatin remodeling as a pathway for epileptogenesis. PMID: 27665729
  13. We conclude that their features better resemble Coffin-Siris syndrome, rather than Nicolaides-Baraitser syndrome and that these features likely arise from SMARCA2 over-dosage. Pure 9p duplications (not caused by unbalanced translocations) are rare. Copy number analysis in patients with features that overlap with Coffin-Siris syndrome is recommended to further determine their genetic aspects. PMID: 27264538
  14. BRM could activate JAK2/STAT3 pathway to promote pancreatic cancer growth and chemoresistance. PMID: 28602977
  15. BRM gene mutation, chromosome 9 monosomy or BRM deletion and CpG methylation contribute collectively to the loss of BRM expression in poorly differentiated clear cell renal cell carcinoma PMID: 28070921
  16. BRM-741 and BRM-1321 insertion polymorphisms are associated with susceptibility to cancer. PMID: 28571677
  17. BRG1/BRM and c-MYC have an antagonistic relationship regulating the expression of cardiac conduction genes that maintain contractility, which is reminiscent of their antagonistic roles as a tumor suppressor and oncogene in cancer. PMID: 28232072
  18. Two functional promoter BRM polymorphisms were not associated with pancreatic adenocarcinoma risk, but are strongly associated with survival. PMID: 27487558
  19. SMARCA4 and SMARCA2 deficiency is observed in 5.1% and 4.8% of non-small cell lung cancer PMID: 28038711
  20. our data suggest that concomitant loss of SMARCA2 and SMARCA4 is another hallmark of small cell carcinoma of the ovary, hypercalcemic type-a finding that offers new opportunities for therapeutic interventions. PMID: 26564006
  21. this study shows for the first time novel SMARCA4-deficient and SMARCA2-deficient variants in undifferentiated gastrointestinal tract carcinomas PMID: 26551623
  22. SMARCA4 loss, either alone or with SMARCA2, is highly sensitive and specific for small cell carcinoma of the ovary, hypercalcaemic type, restoration of either SWI/SNF ATPase can inhibit the growth of SCCOHT cell lines PMID: 26356327
  23. We report, for the first time, co-inactivation and frequent mutations of SMARCB1, SMARCA2 and PBRM1 in MRTs. PMID: 25496315
  24. The miR-199a/Brm/EGR1 axis is a determinant of anchorage-independent growth in epithelial tumor cell lines PMID: 25673149
  25. Knockout of BRG1 or BRM using CRISPR/Cas9 technology resulted in the loss of viability, consistent with a requirement for both enzymes in triple negative breast cancer cells PMID: 25808524
  26. BAF complex gene SMARCA2 is mutated in Coffin-Siris syndrome patients. PMID: 25081545
  27. Phenotype and genotype in Nicolaides-Baraitser syndrome patients with SMARCA2 mutations PMID: 25169058
  28. Over-expression of BRM in melanoma cells that harbor oncogenic BRAF promoted changes in cell cycle progression and apoptosis consistent with a tumor suppressive role. PMID: 25026375
  29. Findings suggest that the BRM promoter double insertion homozygotes may be associated with an increased risk of early-stage UADT cancers independent of smoking status and histology. PMID: 24519853
  30. these data show that the mechanism of BRM silencing contributes to the pathogenesis of Rhabdoid tumors PMID: 24913006
  31. loss of BRM expression is a common feature among poorly differentiated tumours in clear cell renal cell carcinomas. We hypothesize that loss of BRM expression is involved in tumor de-differentiation in clear cell RCCs. PMID: 24471421
  32. Data suggest that Brg1 and Brm integrate various proinflammatory cues into cell adhesion molecule transactivation in endothelial injury. PMID: 23963727
  33. loss of BRM epigenetically induces C/EBPbeta transcription, which then directly induces alpha5 integrin transcription to promote the malignant behavior of mammary epithelial cells PMID: 23770848
  34. A SMARCA2-containing residual SWI/SNF complex underlies the oncogenic activity of SMARCA4 mutant cancers. PMID: 24421395
  35. Depletion of BRM in BRG1-deficient cancer cells leads to a cell cycle arrest, induction of senescence, and increased levels of global H3K9me3. PMID: 24520176
  36. the mitogen-activated protein kinase pathway regulates both BRM acetylation and BRM silencing as MAP kinase pathway inhibitors both induced BRM as well as caused BRM deacetylation. PMID: 23524580
  37. Data indicate that transient knockdown of BRG1 or BRM reduces hypoxia induction of several known HIF1 and HIF2 target genes in Hep3B cells. PMID: 23897427
  38. High SMARCA2 expression is associated with lung cancer PMID: 23872584
  39. BRM expression was lost in 25% of cell lines and 16% of tumors. PMID: 23322154
  40. findings suggest that BRM promoter polymorphism (BRM-1321) could regulate BRM expression and may serve as a potential marker for genetic susceptibility to HCC PMID: 23359823
  41. SMARCA2 rs2296212 and rs4741651 variants were associated with oligodendroglioma risk. PMID: 23276717
  42. Loss of BRG1 and BRM was frequent in E-cadherin-low, TTF-1-low, and vimentin-high cases. PMID: 23163725
  43. Reduced expression of BRM may contribute to the carcinogenesis of hepatocellular carcinoma. PMID: 23088494
  44. SWI/SNF chromatin remodeling complex catalytic subunits Brg1 and Brm modulate cisplatin cytotoxicity by facilitating efficient repair of the cisplatin DNA lesions. PMID: 22721696
  45. sequenced the exomes of ten individuals with Nicolaides-Baraitser syndrome and identified heterozygous variants in SMARCA2 in eight of them. PMID: 22366787
  46. multiple distinct transcriptional patterns of GR and Brm interdependence PMID: 21646426
  47. The expression of BRG1 and BRM correlates with the development of prostatic cancer. PMID: 21092585
  48. results reveal that miR-199a and Brm form a double-negative feedback loop through Egr1, leading to the generation of two distinct cell types during carcinogenesis. PMID: 21189327
  49. The hBrm/Brg1 switch is an indicator of the responsiveness of a gene to heat-shock or IFNgamma stimulation and may represent an "on-off switch" of gene expression in vivo. PMID: 21079652
  50. The methylation levels of CpG islands within Brahma increased during spermatogenesis and decreased during oogenesis PMID: 20719309

Show More

Hide All

Involvement in disease
Nicolaides-Baraitser syndrome (NCBRS); Schizophrenia (SCZD)
Subcellular Location
Nucleus.
Protein Families
SNF2/RAD54 helicase family
Database Links

HGNC: 11098

OMIM: 181500

KEGG: hsa:6595

STRING: 9606.ENSP00000265773

UniGene: Hs.298990

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*