Recombinant Human Prostate-specific antigen (KLK3)

Code CSB-YP012454HU
MSDS
Size Pls inquire
Source Yeast
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP012454HU-B
MSDS
Size Pls inquire
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥85% (SDS-PAGE)
Target Names
Uniprot No.
Alternative Names
Prostate-specific antigen; PSA; EC 3.4.21.77; Gamma-seminoprotein; Seminin; Kallikrein-3; P-30 antigen; Semenogelase; KLK3 APS
Species
Homo sapiens (Human)
Expression Region
25-261
Target Protein Sequence
IVGGWECEKHSQPWQVLVASRGRAVCGGVLVHPQWVLTAAHCIRNKSVILLGRHSLFHPEDTGQVFQVSHSFPHPLYDMSLLKNRFLRPGDDSSHDLMLLRLSEPAELTDAVKVMDLPTQEPALGTTCYASGWGSIEPEEFLTPKKLQCVDLHVISNDVCAQVHPQKVTKFMLCAGRWTGGKSTCSGDSGGPLVCNGVLQGITSWGSEPCALPERPSLYTKVVHYRKWIKDTIVANP
Protein Length
Full Length of Mature Protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Hydrolyzes semenogelin-1 thus leading to the liquefaction of the seminal coagulum.
Gene References into Functions
  1. Genome-wide association study of prostate-specific antigen levels identifies novel loci independent of prostate cancer. PMID: 28139693
  2. Men with mild to no lower urinary tract symptoms (LUTS) but increased baseline PSA are at increased risk of developing incident LUTS presumed due to benign prostatic hyperplasia PMID: 29795141
  3. PSA-density might inform biopsy decisions, and spare some men from the morbidity associated with a prostate biopsy and diagnosis of low-grade prostate cancer. PMID: 29259293
  4. Differences in fPSA-recovery between all investigated assays were even more pronounced. When applying the tPSA cutoff of 3.1 mug/L recommended for WHO-calibrated assays, the use of higher calibrated assays may lead to unnecessary prostate biopsies. Conversely, if the historical threshold of 4 mug/L is applied when using WHO-calibrated assays, it could lead to falsely omitted prostate biopsies. PMID: 29734838
  5. PSA was the only independent predictor of extensive lymph node invasion and could be an important preoperative factor for stratifying high-risk patients. PMID: 29714659
  6. ue to the biocompatibility, multivalency, stability, and high structural homogeneity, the t-PSA-specific landscape phage demonstrates as a novel specific interface in biosensors. PMID: 29414091
  7. Based on the target-induced catalytic hairpin assembly and bimetallic catalyst, the enzyme-free recycling amplification strategy for sensitive detection of prostate specific antigen (PSA) has been designed PMID: 29156407
  8. The prepared biosensor can assay from 0 to 500ng/mL of prostate specific antigen (PSA) level within 2h with the detection limit of 1.18ng/mL by the measurement of resistance change. The resistance change was caused by site selective interaction between PSA and PSA-antigen with an inexpensive bench top digital multimeter (5 1/2 digits) PMID: 29172142
  9. he superwettable f-PSA microchip can accurately detect human serum samples with excellent correlations with chemiluminescence immunoassay in the clinic, demonstrating its great potential as a sensitive and reliable sensing platform for biological analysis and clinical diagnosis. PMID: 29175217
  10. The 12-week PSA response rate was 88% (22/25) and 22% (4/18), median time to PSA progression was 18.2 months [95% confidence interval (CI), 8.3 months-not reached) and 3.7 months (95% CI, 2.8-5.6 months), and median time on treatment 21 months (range, 2.6-37.5) and 4.9 months (range, 1.3-23.2), for the AAP-naive and post-AAP cohorts, respectively. PMID: 28213364
  11. The results support that u-PSA provides useful information for predicting predicting biochemical recurrence after radical prostatectomy . This can be beneficial to avoid unnecessary adjuvant treatments or to start them earlier for selected patients PMID: 27805011
  12. this meta-analysis suggests that PSA -158G/A polymorphism may be a protecting factor against BPH in Caucasian populations, but it may enhance the disease risk in Asians. PMID: 28430620
  13. Developed risk assessment models for North Chinese patients with 4-50 ng/mL PSA to reduce unnecessary prostate biopsies and increase the detection rate of prostate cancer. PMID: 28039477
  14. Data show positive associations of relative Gal-3 and relative PSA levels in prostate cancer patients, notably at early clinical time course. PMID: 27741512
  15. Both the extent of comorbidity and the PSA doubling time should be taken into consideration when deciding on appropriate management and/or clinical trial eligibility at the time of PSA failure. PMID: 28117382
  16. As restaging in advanced prostate cancer patients is often guided by increases in PSA levels, our results demonstrate that disease progression on enzalutamide can occur without rising PSA levels. Therefore, a disease monitoring strategy that includes imaging not entirely reliant on serial serum PSA measurement may more accurately identify disease progression. PMID: 28117385
  17. Older men who underwent no PSA testing or incomplete testing were significantly more likely to be diagnosed with high-risk prostate cancer than those who were previously screened. It is reasonable to consider screening in healthy older men likely to benefit from early detection and treatment. PMID: 28045113
  18. end-of-radiation PSA was significantly associated with survival endpoints in men who received treatment with definitive radiation and ADT. Whether the EOR PSA can be used to modulate treatment intensity merits further investigation. PMID: 28094250
  19. the concentrations of insulin, IGF-1, IGFBP-3 and their association with prostate size in patients with BPH PMID: 28300542
  20. Data suggest that occurrence of PSA failure was associated with increased risk of all-cause mortality (ACM) only in men with no or minimal, but not moderate-to-severe, comorbidity. PMID: 27601545
  21. Microenvironmental acidity determines qualitatively and quantitatively the release of extracellular vesicles by malignant prostate tumors. This leads to the spill-over of nanovesicles into the peripheral blood of prostate cancer patients, where the levels of tumor biomarkers expressed by exosomes, such as PSA-exosomes, may represent a novel, non-invasive diagnostic tool. PMID: 28694142
  22. Promoter methylation of MCAM, ERalpha and ERbeta have a potential to be utilized as biomarker for the early detection of prostate cancer (PC) as their sensitivity and specificity seem to be better than serum PSA. PMID: 28147335
  23. Data suggest no influence of chronic periodontitis treatment on PSA levels in asymptomatic men. PMID: 28551659
  24. Circulating total PSA levels were strongly associated to leukocyte telomere length in a national sample of men without prostate cancer. PMID: 27566127
  25. I might also point out that whether a particular surgical procedure did more good than harm at that time was highly dependent on whether it was conducted with good sterile procedure. PSA screening is a contemporary example of this historical lesson PMID: 27010733
  26. Data show that forkhead box M1 protein (FOXM1) directly binds to the FHK binding motifs in the prostate specific antigen (PSA) promoter/enhancer regions. PMID: 28199985
  27. Study suggests that the prognostic value of PSA declines in heavily treated patients receiving enzalutamide PMID: 28614217
  28. novel urinary gene expression signature that may be the least invasive of available options by not requiring a digital rectal examination or phlebotomy as a reflex test in men for whom PSA testing raises the suspicion of prostate cancer PMID: 27031887
  29. For PSA screening to be cost-effective, it needs to be used conservatively and ideally in combination with a conservative management approach for low-risk disease PMID: 27010943
  30. Both the incidence of early-stage prostate cancer and rates of PSA screening have declined and coincide with 2012 USPSTF recommendation to omit PSA screening from routine primary care for men. Longer follow-up is needed to see whether these decreases are associated with trends in mortality. PMID: 27010657
  31. Distinctive immunohistochemical expression of PAX8 and lack of prostate-specific antigen can help in distinguishing this benign entity from prostatic adenocarcinoma. PMID: 21606823
  32. Circulating prostate-derived PSA and membrane PSM mRNA pre- and post-radical prostatectomy improves accuracy of a nomogram to predict biochemical recurrence of prostate cancer. PMID: 22228175
  33. Purified PSA cleaves complement factor iC3b in a previously uncharacterized function of PSA as an immunoregulatory serine protease that can help create an environment hospitable to malignancy through proteolysis of the complement system. PMID: 23401592
  34. Extended follow-up of the PLCO trial over a median of 15 years continues to indicate no reduction in prostate cancer mortality for the intervention arm versus the control arm. Because of the high rate of control-arm PSA testing, this finding can be viewed as showing no benefit of organized screening versus opportunistic screening PMID: 27911486
  35. Data indicate that prostate specific antigen (PSA) is a negative predictive biomarker for local recurrence during follow-up. PMID: 27834929
  36. TC genotype of rs1058205 lower in prostate cancer group than in control group; TT genotype associated with prostate cancer PMID: 28272245
  37. The prostate-specific antigen density (PSAD) cutoff level generated for Nigerian men in this study is 0.04 which is relatively different from international consensus. This PSAD cutoff level has a positive correlation with histology and could detect patients with prostate cancer who have "grey zone PSA." PMID: 27356753
  38. The combined efficacies of whole-body magnetic resonance imaging, bone scintigraphy and PSA levels were desired in identifying prostate cancer lesions and prognosis. PMID: 27941343
  39. A combination of high preoperative serum PSA and high expression of TMPRSS2-ERG could be promising in distinguishing those tumors that are aggressive and life-threatening. PMID: 27630329
  40. Higher miR-139-5p expression in prostate cancer patients was observed to be associated with certain clinicopathological parameters, including PSA greater than 20ng/ml, pathological tumor stage, and Gleason score. PMID: 27562849
  41. PSA velocity can be more predictive after surgery and PSA doubling time can be more predictive after radiation therapy. PMID: 26767890
  42. Prostate health index achieved the best predictive performance for detecting prostate cancer and was not influenced by body mass index. PMID: 26754552
  43. Salvage radiotherapy conferred better prostate cancer control when administered at the very first sign of PSA rise. PMID: 26497924
  44. Studies indicate that the prostate health index (phi) is a biomarker panel that includes free prostate-specific antigen (PSA), total PSA, and [-2]proPSA. PMID: 27023445
  45. PSCA TT genotype is associated with a more than a threefold increase in the prevalence and the extent of gastric mucosal intestinal mucosa compared to C allele carriers among H. pylori-infected Bhutanese. PMID: 26706772
  46. Prostate magnetic resonance imaging before prostate biopsy appeared to offer similar diagnostic accuracy compared with routine transrectal ultrasound-guided random biopsy in the diagnosis of suspected prostate cancer based on elevated prostate specific antigen values. PMID: 26033153
  47. We observed an association of higher Ki-67 expression with Gleason sum National Comprehensive Cancer Network risk (P=0.013) and PSA recurrence PMID: 26458958
  48. Results show that urinary PSA glycoforms are able to discriminate prostate cancer from protastatic hyperplasia with higher sensitivity and specificity for prostate cancer than those of the serum PSA marker. PMID: 27065039
  49. No significant differences in in KLK3 expression were found between radical prostatectomy-prostate cancer and radical prostatectomy-benign samples. PMID: 26928323
  50. BMI should be taken into consideration when referring men to a prostate biopsy based on serum PSA-levels. PMID: 26914149

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
Peptidase S1 family, Kallikrein subfamily
Database Links

HGNC: 6364

OMIM: 176820

KEGG: hsa:354

STRING: 9606.ENSP00000314151

UniGene: Hs.171995

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1