Recombinant Human Proteasome activator complex subunit 3 (PSME3)

In Stock
Code CSB-EP018918HU
Abbreviation Recombinant Human PSME3 protein
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Apoptosis
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
2-254aa
Target Protein Sequence
ASLLKVDQEVKLKVDSFRERITSEAEDLVANFFPKKLLELDSFLKEPILNIHDLTQIHSDMNLPVPDPILLTNSHDGLDGPTYKKRRLDECEEAFQGTKVFVMPNGMLKSNQQLVDIIEKVKPEIRLLIEKCNTVKMWVQLLIPRIEDGNNFGVSIQEETVAELRTVESEAASYLDQISRYYITRAKLVSKIAKYPHVEDYRRTVTEIDEKEYISLRLIISELRNQYVTLHDMILKNIEKIKRPRSSNAETLY
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
36.8 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The creation of the recombinant Human PSME3 protein is achieved through genetic engineering techniques. A specific DNA sequence coding for the Human PSME3 protein (2-254aa) is integrated into an expression vector, which serves as a carrier for gene expression. This vector is then introduced into e.coli cells, which are cultured to facilitate the expression of the desired protein. The protein is fused with a N-terminal 10xHis tag and C-terminal Myc tag. The recombinant Human PSME3 protein is subsequently purified using affinity purification, resulting in a purity level exceeding 90%, as verified by SDS-PAGE analysis.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Subunit of the 11S REG-gamma (also called PA28-gamma) proteasome regulator, a doughnut-shaped homoheptamer which associates with the proteasome. 11S REG-gamma activates the trypsin-like catalytic subunit of the proteasome but inhibits the chymotrypsin-like and postglutamyl-preferring (PGPH) subunits. Facilitates the MDM2-p53/TP53 interaction which promotes ubiquitination- and MDM2-dependent proteasomal degradation of p53/TP53, limiting its accumulation and resulting in inhibited apoptosis after DNA damage. May also be involved in cell cycle regulation. Mediates CCAR2 and CHEK2-dependent SIRT1 inhibition.
Gene References into Functions
  1. Knockdown of REG-GAMMA (REGgamma) may inhibit the proliferation and migration, and promote the apoptosis of plasma cell myeloma RPMI-8226 cells possibly by downregulating NF-kappa-B (NF-kappaB) signal pathway. PMID: 29020881
  2. data show that PIP30 deeply affects PA28gamma interactions with cellular proteins, including the 20S proteasome, demonstrating that it is an important regulator of PA28gamma in cells and thus a new player in the control of the multiple functions of the proteasome within the nucleus. PMID: 29934401
  3. the ubiquitin-independent REGgamma proteasome regulates energy homeostasis PMID: 27511885
  4. High expression of REGg seemed positively correlated with T-stage and lymph node metastasis in papillary thyroid carcinoma tissues. PMID: 29509725
  5. This study demonstrates that REGgamma is a central molecule in the development of melanoma by regulating Wnt/beta-catenin pathway. PMID: 28605165
  6. that Proteasome activator subunit 3 induces epithelial-mesenchymal transition with inducing the expression of CSC markers and influencing the tumor immune microenvironment in breast cancer PMID: 28529105
  7. PSME3 plays an oncogenic role in pancreatic cancer by inhibiting c-Myc degradation to promote glycolysis. PMID: 27756569
  8. Study demonstrated that the gene therapy with proteasome activator, PA28gamma can improve ubiquitin-proteasome system function as well as behavioral abnormalities in Huntington's disease model mice PMID: 26944602
  9. Surrogate Prognostic Biomarkers in OSCC: The Paradigm of PA28gamma Overexpression. PMID: 26425675
  10. PA28gamma in OSCC tumor tissues were significantly high expression than those in normal tissues. PMID: 26425691
  11. REGgamma acts in skin tumorigenesis mediating MAPK/p38 activation of the Wnt/beta-catenin pathway. PMID: 25908095
  12. Results show molecular cloning of a novel transcript variant encoding a truncated form of PA28G likely involved in cell cycle regulation and apoptosis. PMID: 25936920
  13. In a p53-dominated cellular context, pro-apoptotic signaling might be overcome by PA28gamma-mediated caspase inhibition. PMID: 26201457
  14. Our results suggest that the high expression of REGgamma might predict metastasis and poor prognosis in breast cancer. PMID: 25550823
  15. Increased PA28gamma sera levels were prognostic of disease activity in rheumatoid arthritis. PMID: 25482151
  16. Data suggest levels of gene expression of both PSME3 (proteasome activator subunit 3) and DUSP3 (dual specificity phosphatase 3) are associated with susceptibility to Staphylococcus aureus infection/sepsis in humans and in mouse disease model. PMID: 24901344
  17. Examination of EC and normal endometrium specimens confirmed the oncogenic role of REGgamma, in that REGgamma was more highly overexpressed in p53-positive specimens than in p53-negative specimens. PMID: 25697482
  18. PA28 gamma and p53 form a negative feedback loop that maintains the balance of p53 and PA28gamma in the cells. PMID: 24531141
  19. Our data indicate that miR-7-5p has a critical function through blocking REGgamma in breast cancer cells. PMID: 25511742
  20. REGgamma expression is positively correlated with ERalpha status and poor clinical prognosis in ERalpha positive breast cancer patients PMID: 25490392
  21. The results link Chk2 and REGgamma to the mechanism underlying the DBC1-dependent SIRT1 inhibition. PMID: 25361978
  22. PKA turnover by the REGgamma-proteasome modulates FoxO1 cellular activity and VEGF-induced angiogenesis. PMID: 24560667
  23. Expression of PA28gamma contributes to carcinogenesis and progression of colorectal cancer. PMID: 24113729
  24. The REGgamma-proteasome pathway is regulated differentially by p53/TGF-beta signaling and mutant p53 in cancer cells. PMID: 24157709
  25. the regulation of REGgamma assembly and activity, suggesting a potential venue for the intervention of the ubiquitin-independent REGgamma proteasome activity. PMID: 23612972
  26. PA28gamma acts as a co-repressor of HTLV-1 p30 to suppress virus replication and is required for the maintenance of viral latency. PMID: 23104922
  27. statistical analysisof laryngeal carcinomas revealed that there was a positive relationship between the level of REGgamma and the expression of p53 and p2; study suggests that REgamma overexpression can facilitate the growth of laryngeal cancer cells PMID: 22938444
  28. PA28gamma is an ATM target, being recruited to DNA damage sites where it is required for rapid accumulation of proteasomes, and the timely coordination of DNA double-strand break repair. PMID: 22134242
  29. REG-gamma associates with and modulates the abundance of nuclear activation-induced deaminase. PMID: 22042974
  30. A previously unrecognized mechanism regulating the activity of the proteasome activator REGgamma, is reported. PMID: 21445096
  31. High REGgamma expression is associated with breast cancer and its metastatic lymph nodes. PMID: 20467919
  32. HTLV-1 p30 interacts with ATM and REGgamma to increase viral spread by facilitating cell survival PMID: 21216954
  33. REGgamma regulates cellular distribution of p53 by facilitating its multiple monoubiquitylation and nuclear export. PMID: 21084564
  34. REGgamma-mediated p53 proteolysis contributes, as least in part, to the proviral function of REGgamma; the host REGgamma pathway is utilized and modified during CVB3 infection to promote efficient viral replication PMID: 20719955
  35. REGgamma is present in many tissues and the highest expression is in the testis. PMID: 20494959
  36. PA28gamma participates not only in the pathogenesis but also in the propagation of HCV by regulating the degradation of the core protein in both a ubiquitin-dependent and ubiquitin-independent manner PMID: 20683941
  37. Overexpression of the proteasome activator subunit PA28gamma recovered proteasome function in Huntington disease cells. It improved cell viability in mutant huntingtin-expressing striatal neurons exposed to pathological stressors. PMID: 17327906
  38. Data suggest REGgamma promoting tumor growth is a process involving multiple factor mechanisms. PMID: 19656465
  39. PA28gamma is an endogenous substrate for caspase-3 and -7 PMID: 11859414
  40. Ki antigen contains multiple epitopes recognized by autoimmune sera PMID: 12784391
  41. PA28 gamma novel regulator of Cajal body integrity in response to ultraviolet radiation. PMID: 17088425
  42. REGgamma proteasome activator is involved in the maintenance of chromosomal stability. PMID: 18235248
  43. PA28gamma, a proteasome activator that inhibits apoptosis and promotes cell cycle progression through unknown mechanisms, exerts an effect as a cofactor in the MDM2-p53 interaction. PMID: 18309296
  44. PA28gamma/REGgamma, which specifically binds to hepatitis c virus core protein, is required for the virulence of the core protein[review] PMID: 18321762
  45. mammalian proteasomes cannot degrade glutamine-expanded regions within pathogenic polyQ-expanded proteins, such as Huntingtin PMID: 18343811
  46. PA28gamma specifically binds to hepatitis C virus core protein and is involved in its degradation. PMID: 19091860
  47. these results underline a new role for REGgamma in the control and regulation of promyelocytic leukemia subnuclear structures. PMID: 19556897

Show More

Hide All

Subcellular Location
Nucleus. Cytoplasm.
Protein Families
PA28 family
Database Links

HGNC: 9570

OMIM: 605129

KEGG: hsa:10197

STRING: 9606.ENSP00000293362

UniGene: Hs.152978

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*