Recombinant Human Protein ADM2 (ADM2), partial

In Stock
Code CSB-EP801808HUc7
Abbreviation Recombinant Human ADM2 protein, partial
MSDS
Size $256
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Signal Transduction
Alternative Names
Intermedin
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
101-147aa
Target Protein Sequence
TQAQLLRVGCVLGTCQVQNLSHRLWQLMGPAGRQDSAPVDPSSPHSY
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
12.0 kDa
Protein Length
Partial
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
May play a role as physiological regulators of gastrointestinal, cardiovascular bioactivities mediated by the CALCRL/RAMPs receptor complexes. Activates the cAMP-dependent pathway.; May play a role as physiological regulators of gastrointestinal, cardiovascular bioactivities mediated by the CALCRL/RAMPs receptor complexes. Activates the cAMP-dependent pathway.
Gene References into Functions
  1. IMD may be an important self-protective factor in response to sepsis. PMID: 29980671
  2. The plasma ADM2 levels were inversely correlated with obesity in humans, and adipo-ADM2-transgenic (tg) mice displayed resistance to high-fat diet-induced obesity with increased energy expenditure. PMID: 27621315
  3. Mouse and human heart valves expressed mRNAs for the CRL ligands adrenomedullin (AM), adrenomedullin-2 (AM-2) and calcitonin gene-related peptide (CGRP) and for their receptor components, i.e., CRL and receptor-activity-modifying proteins 1-3. PMID: 27553639
  4. ADM-2 is a stress-inducible gene controlled by ATF-4. PMID: 27328454
  5. Intermedin1-53 may attenuate vascular calcification by upregulating alpha-Klotho via the calcitonin receptor/modifying protein complex and protein kinase A signaling. PMID: 26880455
  6. Intermedin (IMD) derived from human cardiac microvascular endothelial cell and acting in a paracrine manner on cardiomyocytes, predominantly at AM1 receptors, is more likely to contribute to direct protection by endogenous IMD of cardiomyocytes against acute ischemia reperfusion injury. PMID: 26743504
  7. Elevated plasma intermedin levels are independently associated with long-term recurrence and distant metastasis of prostate cancer. PMID: 26406405
  8. ADM2 may contribute to the physiology of embryo implantation and placental growth via increasing MMP2 and decreasing MUC1 expression to facilitate trophoblast invasion. PMID: 26510869
  9. Plasma intermedin and BNP levels were markedly higher in acute coronary syndrome patients than in healthy people. PMID: 23391507
  10. High levels of ADM2 expression predict a poorer survival in patients with pancreatic adenocarcinoma. PMID: 25982376
  11. TSH induced AM2/IMD expression in the thyroid gland and it could locally work as a potent vasodilator, resulting in the expansion of thyroid inter-follicular capillaries. PMID: 25102228
  12. Intermedin affects the endothelial cell junction and blood vessel sprouting in a VE-cadherin dependent way. PMID: 25637664
  13. results suggest that high plasma intermedin level is associated with poor outcomes of patients and may be a useful prognostic biomarker in ST-segment elevation acute myocardial infarction. PMID: 24969626
  14. ADM and IMD mRNA expression are elevated in chronic heart failure at different stages of the disease. PMID: 24531032
  15. a significant increase in plasma intermedin following acute myocardial infarction may be associated with oxidative stress, and could be used as a marker to reflect the severity of the coronary stenosis PMID: 23499766
  16. this study is the first to demonstrate a potential involvement of IMD in human embryo implantation and placental development via regulation of trophoblast invasion at the maternal-fetal interface PMID: 23337723
  17. Intermedin plays a critical role in the vascular remodeling process and tumor angiogenesis by regulating vascular endothelial-cadherin and extracellular signal-regulated kinase. PMID: 22922959
  18. adm2 polymorphism is associated with renal dysfunction, blood pressure regulation and asymptomatic cerebrovascular diseases in the Japanese general population PMID: 21832999
  19. potentially involved in regulating HLA-G antigen at the maternal-fetal interface and facilitating trophoblast invasion and migration via MAPK3/1 phosphorylation PMID: 21816853
  20. Data showed that intermedin (IMD)/adrenomedullin 2 (ADM2) is a novel oocyte-derived ligand important for the regulation of cell interactions in COCs that functions, in part, by suppressing cumulus cell apoptosis. PMID: 22009752
  21. Intermedin reduces HUVEC permeability via Rac1-mediated actin cytoskeleton rearrangement. PMID: 21816966
  22. Adrenomedullin-related peptide, AM2 was highly expressed in colorectal cancer tissue. The percent increase of AM2 synthesis in cancer tissues to the surrounding normal tissues was greater than adrenomedullin. PMID: 21839130
  23. IMD may be an endogenous vasoprotective factor for vascular calcification PMID: 19910445
  24. may have a role in the physiology of human pregnancy via regulation of trophoblast invasion and migration PMID: 19535789
  25. Intermedin is a calcitonin/calcitonin gene-related peptide family peptide acting through the calcitonin receptor-like receptor/receptor activity-modifying protein receptor complexes PMID: 14615490
  26. ADM2 may be related to the central and peripheral regulation of the circulation and water-electrolyte metabolism PMID: 16359754
  27. IMD expressed by pericytes in has a role in susceptibility of the skin of atopic dermatitis patients to inflammatory stimuli PMID: 17008878
  28. Study has shown expression of AM2/IMD in various types of cells in the central nervous system and the cardiovascular system, and suggested possible (patho)physiological roles of AM2/IMD in these systems. PMID: 17346853
  29. robust increase in expression of the peptide in hypertrophied and ischaemic myocardium indicates an important protective role for adrenomedullin 2 as an endogenous counter-regulatory peptide in the heart--REVIEW PMID: 17965749
  30. adrenomedullin 2/intermedin may have autocrine/paracrine regulatory roles in adrenal tumors and attached non-neoplastic adrenal tissues, such as tumor growth. PMID: 18460550
  31. Vascular injury in rat kidney is reduced by IMD gene delivery and it prevents glomerular and peritubular capillary loss. PMID: 18829738
  32. Data show that adrenomedullin-2 was shown to be secreted by HAEC and may play a potential protective role in human aortic endothelial cells. PMID: 19255504
  33. IMD enhances angiogenesis through ERK, Akt/NOS/NO, and VEGF/VEGFR-2 signaling pathways PMID: 19592612
  34. IMD is a novel hypoxia-induced gene and a potential interventional agent for the improvement of endothelial barrier function in systemic inflammatory responses and hypoxia-induced vascular leakage. PMID: 19684198

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
Adrenomedullin family
Tissue Specificity
Expressed in the esophagus, stomach, jejunum, ileum, ileocecum, ascending colon, transverse colon, descending colon and rectum. Expressed in myocardial cells of the heart, renal tubular cells, hypothalamus, and pituitary.
Database Links

HGNC: 28898

OMIM: 608682

KEGG: hsa:79924

STRING: 9606.ENSP00000379086

UniGene: Hs.449099

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*