Recombinant Human Protein FAM167A(FAM167A)

In Stock
Code CSB-MP836244HU
Product Type Recombinant Protein
Size US$1848
Uniprot No. Q96KS9
Abbreviation FAM167A
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of Mammalian Cell host and target protein, the LC-MS/MS Analysis result of CSB-MP836244HU could indicate that this peptide derived from Mammalian Cell-expressed Homo sapiens (Human) FAM167A.
  • Based on the SEQUEST from database of Mammalian Cell host and target protein, the LC-MS/MS Analysis result of CSB-MP836244HU could indicate that this peptide derived from Mammalian Cell-expressed Homo sapiens (Human) FAM167A.
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MSVPQIHVEEVGAEEGAGAAAPPDDHLRSLKALTEKLRLETRRPSYLEWQARLEEHTWPFPRPAAEPQASLEEGERGGQEPLLPLREAGQHPPSARSASQGARPLSTGKLEGFQSIDEAIAWLRKELTEMRLQDQQLARQLMRLRGDINKLKIEHTCRLHRRMLNDATYELEERDELADLFCDSPLASSFSLSTPLKLIGVTKMNINSRRFSLC
Research Area Others
Source Mammalian cell
Gene Names FAM167A
Protein Names Recommended name: Protein FAM167A
Expression Region 1-214aa
Tag Info N-terminal 10xHis-tagged and C-terminal Myc-tagged
Mol. Weight 28.2kDa
Protein Description Full Length
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat

Related Products

FAM167A Antibodies

FAM167A Antibodies for Human

FAM167A Antibodies for Homo sapiens (Human)

FAM167A Proteins

FAM167A Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.