Recombinant Human Protein FAM167A (FAM167A)

^{In Stock}

Code	CSB-MP836244HU
Abbreviation	Recombinant Human FAM167A protein
MSDS	MSDS Datasheet
Size	$660
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Based on the SEQUEST from database of Mammalian Cell host and target protein, the LC-MS/MS Analysis result of CSB-MP836244HU could indicate that this peptide derived from Mammalian Cell-expressed Homo sapiens (Human) FAM167A. Based on the SEQUEST from database of Mammalian Cell host and target protein, the LC-MS/MS Analysis result of CSB-MP836244HU could indicate that this peptide derived from Mammalian Cell-expressed Homo sapiens (Human) FAM167A.
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

FAM167A

Uniprot No.

Q96KS9

Research Area

Others

Alternative Names

FAM167A; C8orf13Protein FAM167A

Species

Homo sapiens (Human)

Source

Mammalian cell

Expression Region

1-214aa

Target Protein Sequence

MSVPQIHVEEVGAEEGAGAAAPPDDHLRSLKALTEKLRLETRRPSYLEWQARLEEHTWPFPRPAAEPQASLEEGERGGQEPLLPLREAGQHPPSARSASQGARPLSTGKLEGFQSIDEAIAWLRKELTEMRLQDQQLARQLMRLRGDINKLKIEHTCRLHRRMLNDATYELEERDELADLFCDSPLASSFSLSTPLKLIGVTKMNINSRRFSLC
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

28.2kDa

Protein Length

Full Length

Tag Info

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

To express the recombinant Human FAM167A protein in mammalian cells, a DNA fragment encoding the Human FAM167A protein (1-214aa) is inserted into a plasmid vector and transferred to the mammalian cells. Cells containing the plasmid are screened, cultured, and induced to express the FAM167A protein. The protein carries a N-terminal 10xHis tag and C-terminal Myc tag. Lysing the cells allows for the collection of the recombinant Human FAM167A protein, which is purified through affinity purification and then identified through SDS-PAGE and subsequent staining of the gel with Coomassie Brilliant Blue. The purity of the recombinant Human FAM167A protein obtained is greater than 90%.