Recombinant Human Protein S100-B (S100B)

Code CSB-YP020643HU
MSDS
Size Pls inquire
Source Yeast
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP020643HU
MSDS
Size Pls inquire
Source E.coli
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP020643HU-B
MSDS
Size Pls inquire
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-BP020643HU
MSDS
Size Pls inquire
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-MP020643HU
MSDS
Size Pls inquire
Source Mammalian cell
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥85% (SDS-PAGE)
Target Names
Uniprot No.
Alternative Names
Protein S100-B; S-100 protein beta chain; S-100 protein subunit beta; S100 calcium-binding protein B; S100B
Species
Homo sapiens (Human)
Expression Region
2-92
Target Protein Sequence
SELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE
Protein Length
Full Length of Mature Protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Weakly binds calcium but binds zinc very tightly-distinct binding sites with different affinities exist for both ions on each monomer. Physiological concentrations of potassium ion antagonize the binding of both divalent cations, especially affecting high-affinity calcium-binding sites. Binds to and initiates the activation of STK38 by releasing autoinhibitory intramolecular interactions within the kinase. Interaction with AGER after myocardial infarction may play a role in myocyte apoptosis by activating ERK1/2 and p53/TP53 signaling. Could assist ATAD3A cytoplasmic processing, preventing aggregation and favoring mitochondrial localization. May mediate calcium-dependent regulation on many physiological processes by interacting with other proteins, such as TPR-containing proteins, and modulating their activity.
Gene References into Functions
  1. rs9722, a functional SNP in the 3'-UTR of the S100B gene, was strongly associated with age of onset of Parkinson's disease. PMID: 29529989
  2. The S100B gene rs9722 polymorphism may contribute to the susceptibility of IS. PMID: 29343763
  3. It is unclear if the higher S100B concentration in football players playing at least 50 plays was caused by exercise or impacts. Therefore, if serum S100B is to be used as a biomarker of impacts, and possible brain injury in sport, exercise time and intensity should be taken into account as confounding variables. PMID: 30203865
  4. High S100B expression is associated with chemoresistance in ovarian cancer. PMID: 29956807
  5. The serum levels of S100B in Groups A and B rose after the injury and reached a peak on the 4th day of injury. Serum levels of NSE and S100B protein can reflect the degree of spinal cord injury. PMID: 29959890
  6. Serum levels of S100B (and neuron-specific enolase) at admission were related to initial Glasgow Coma Scale (GSC) scores, and these levels one week after traumatic brain injury were related to six month GSC scores. PMID: 30257306
  7. Studied use of serum S100B as a biomarker to predict injury in patients with mild head injury. Found patients with cranial injury detected by CT, had higher S100B protein levels than those without cranial injury. PMID: 29850551
  8. The expression of serum S100beta in patients with postoperative cognitive dysfunction was significantly increased PMID: 28537663
  9. A high S100B expression is associated with a good prognosis in patients with p53 mutant and p53 wild-type breast cancers. PMID: 29345293
  10. S100B may have a role in pathogenesis of schizophrenia; patients show higher plasma levels of S100B than healthy controls PMID: 27279465
  11. We investigated the possible correlation between TCD results and S100B, NSE and LDH levels as well as between NSE-LDH and S100B-LDH levels by regression analysis. We found a statistically significant relationship for both NSE, S100B with LDH. PMID: 29244749
  12. Results showed that our prepared S100B mAbs were suitable for detecting S100B expression in human tissues, furnishing promising tools for further functional investigation and clinical applications. PMID: 28849099
  13. In this study demonstrated that S100b is elevated in Alzheimer disease cases. and the increased levels in African Americans here may be indicative of increased severity in specific populations. PMID: 28582866
  14. In neonates, NSE and s100B levels increase after bypass surgery and return below preoperative baseline levels by postoperative day seven. The levels of s100B were positively correlated with circulatory arrest time and negatively correlated with age at time of surgery. PMID: 28571730
  15. the serum levels of S100B protein mediated the association between S100B gene polymorphism and scene selectivity in the retrosplenial cortex PMID: 26733530
  16. There is a significant correlation between mortality in the critically ill patients in the intensive care unit and increased serum concentration of S100B and NSE. PMID: 29222857
  17. Our findings showed that both S100beta and NSE levels similarly increased during CPB and immediately after CPB during sevoflurane and propofol based anesthesia. PMID: 26856295
  18. This study demonstrated that S100A12 mRNA levels were significantly decreased in the new cases of untreated MS patients in comparison to healthy controls. PMID: 28433998
  19. Increased serum levels of S100B protein (and NSE) were observed postoperatively in patients with postoperative cognitive dysfunction. PMID: 27433840
  20. high S100B expression in Multiple Sclerosis (MS) patient samples suggests its usefulness as a diagnostic biomarker for MS. PMID: 26184632
  21. the underlying mechanism of S100B-mediated effects on cancer stem-like cell stemness was not dependent on its binding with a receptor for advanced glycation end products (RAGE), but might be through intracellular regulation, through the inhibition of p53 expression and phosphorylation. PMID: 27501952
  22. Data show that a high serum S100beta protein level, hypertension, and high low density lipoprotein-cholesterol (LDL-C) level were the independent risk factors for cerebral small vessel disease (SVD). PMID: 28143956
  23. the serum concentrations of S100B are increased in bipolar disorder patients. PMID: 27475892
  24. Levels of NSE and S100B are still elevated 1 year postpartum in women who have had preeclampsia in contrast to women with previous normal pregnancies. PMID: 27653032
  25. In vitro experiments using repeated freeze-thaw procedures showed an intracellular up-regulation of S100B in normal and vitiligo melanocytes before an extensive release in the environment. PMID: 28212812
  26. Acute paranoid schizophrenia inpatients present a day/night change of S100B serum levels at admission that disappears at discharge. PMID: 28188811
  27. Results show that S100beta protein levels are increased in childhood-onset SLE with cognitive impairment suggesting that elevated S100beta protein levels were associated with cognitive impairment. PMID: 28394234
  28. Compared to the control, the S100B/GAPDH mRNA ratio was significantly decreased in chronic liver diseases (p = 0.006) and most decreased in chronic hepatitis C patients (p = 0.023). We here evaluated S100B expression as a marker of hepatic nerves in patients with various chronic liver diseases, topographically and semi-quantitatively. PMID: 27255110
  29. results indicate there were decreased S100B serum levels in bipolar patients in a manic phase after treatment. PMID: 28088747
  30. Studies indicate that S100 calcium binding protein B protein (S100B) has high affinity for zinc (Zn2+). PMID: 27430886
  31. S100beta has potential as a new surveillance tool for patients with ER-positive breast cancer to monitor endocrine therapy. PMID: 28399921
  32. For patients recruited PMID: 28419114
  33. Our study provides information on the dynamic changes of MMP-9-TIMP-1 system and S100B in the perioperative period. Preoperative reduction of TIMP-1 might be predictive for shunt requirement but future studies are required for verification. PMID: 27121520
  34. this study shows that low levels of S100B correlate to a better anti-CTLA-4 immunotherapy response and survival in advanced melanoma patients PMID: 27728898
  35. Our data suggest that elevated S100B protein levels might indicate neuronal damage in the brains of people with cannabis use disorder. PMID: 26624020
  36. The strong CD68 and S100 co-expression in our case did not allow a clear-cut discrimination between the immunophenotype of histiocytic neoplasms and amelanotic melanoma, because of CD68 immunoreactivity occurring in 75% of metastatic malignant melanomas PMID: 26407839
  37. Cognitive deterioration could not be predicted using perioperative embolic load and S-100beta changes after carotid revascularization. PMID: 27395808
  38. Serum S100B protein levels increased after general anaesthesia. The values of S100Bp (median 164.0 ng/L) were significantly higher than the values of S100Bb (median 94.5 ng/L). The median of the difference between S100Bp and S100Bb was 58.0 ng/L. There were statistically significant differences between S100Bb and S100Bp. PMID: 26969427
  39. Although an elevation in S100B was not observed in this (second) ascent during re-exposure to the hypobaric hypoxia of high altitude for either the non-treated (acclimatised) or the dexamethasone treated (acclimatised and dexamethasone) groups, the hypothesis that S100B would reduce following acclimatisation could not be statistically confirmed in our study given the wide confidence intervals and small sample size PMID: 26924650
  40. Serum S100B is a useful quantitative biomarker in routine follow-up of high-risk melanoma patients. PMID: 26819111
  41. serum levels may be correlated with the carbon monoxide poisoning and could be biomarker for early diagnosis and treatment monitoring PMID: 25925764
  42. Our results support the hypothesis that S-100beta is an important biological indicator of HIE and serum S-100beta levels can be used as a reference index to assess hypoxic-ischemic encephalopathy severity. PMID: 26600537
  43. There was no association found between serum and CSF S100B with radiographic vasospasm or DIND. S100B is a potential prognostic marker for aSAH outcome PMID: 27007976
  44. Fetuses of active smoker mothers had lower cord blood S100B levels compared to fetuses of non-smoker mothers. PMID: 24668715
  45. This study inquires into the physiological concentrations of NSE and S100B proteins in CSF, carried out on a sufficiently large group of 601 patients. PMID: 26421286
  46. Studied circulating S100B and adiponectin in children who underwent open heart surgery. S100B showed a significant increase from hospital admission up to 24 h after procedure. PMID: 26417594
  47. Concentrations of serum S100B protein in brain-dead organ donors are extremely high and may support the diagnosis of brain death. PMID: 26401738
  48. long-term exposure to high blood glucose concentrations leads to an increase in total oxidant in patients with diabetic ketoacidosis ( and that the neurotransmitter changes that develop in response to this exposure lead to an increase in S100B levels PMID: 26316432
  49. plasma biomarkers S100-B and copeptin did not improve prediction of poor outcome following seizure PMID: 25849778
  50. S100B serum levels are elevated in cerebral small vessel disease patients. PMID: 25990800

Show More

Hide All

Subcellular Location
Cytoplasm. Nucleus.
Protein Families
S-100 family
Tissue Specificity
Although predominant among the water-soluble brain proteins, S100 is also found in a variety of other tissues.
Database Links

HGNC: 10500

OMIM: 176990

KEGG: hsa:6285

STRING: 9606.ENSP00000291700

UniGene: Hs.422181

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1