Recombinant Human Protein SET (SET)

Code CSB-YP875345HU
MSDS
Size Pls inquire
Source Yeast
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP875345HU
MSDS
Size Pls inquire
Source E.coli
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP875345HU-B
MSDS
Size Pls inquire
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-BP875345HU
MSDS
Size Pls inquire
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-MP875345HU
MSDS
Size Pls inquire
Source Mammalian cell
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
>85% (SDS-PAGE)
Target Names
SET
Uniprot No.
Alternative Names
Protein SET; HLA-DR-associated protein II; Inhibitor of granzyme A-activated DNase; IGAAD; PHAPII; Phosphatase 2A inhibitor I2PP2A; I-2PP2A; Template-activating factor I; TAF-I; SET
Species
Homo sapiens (Human)
Expression Region
2-290
Target Protein Sequence
APKRQSPLPPQKKKPRPPPALGPEETSASAGLPKKGEKEQQEAIEHIDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVTTFVNHPQVSALLGEEDEEALHYLTRVEVTEFEDIKSGYRIDFYFDENPYFENKVLSKEFHLNESGDPSSKSTEIKWKSGKDLTKRSSQTQNKASRKRQHEEPESFFTWFTDHSDAGADELGEVIKDDIWPNPLQYYLVPDMDDEEGEGEEDDDDDEEEEGLEDIDEEGDEDEGEEDEDDDEGEEGEEDEGEDD
Protein Length
Full Length of Mature Protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Multitasking protein, involved in apoptosis, transcription, nucleosome assembly and histone chaperoning. Isoform 2 anti-apoptotic activity is mediated by inhibition of the GZMA-activated DNase, NME1. In the course of cytotoxic T-lymphocyte (CTL)-induced apoptosis, GZMA cleaves SET, disrupting its binding to NME1 and releasing NME1 inhibition. Isoform 1 and isoform 2 are potent inhibitors of protein phosphatase 2A. Isoform 1 and isoform 2 inhibit EP300/CREBBP and PCAF-mediated acetylation of histones (HAT) and nucleosomes, most probably by masking the accessibility of lysines of histones to the acetylases. The predominant target for inhibition is histone H4. HAT inhibition leads to silencing of HAT-dependent transcription and prevents active demethylation of DNA. Both isoforms stimulate DNA replication of the adenovirus genome complexed with viral core proteins; however, isoform 2 specific activity is higher.
Gene References into Functions
  1. hsa_circ_0000673 promoted hepatocellular carcinoma malignant behaviors via regulating miR-767-3p/SET pathway. PMID: 29627570
  2. Findings indicate that TCE may induce hepatocyte apoptosis via SET-mediated dephosphorylation and overexpression of nucleolin. PMID: 28402964
  3. Recent studies showed that SET is overexpressed in breast cancers, ovary cancers and other malignancies. The strong correlation between SET expression levels and survival of ovarian cancer patients, and SET-mediated activation of androgen synthesis, strongly indicate a significant role in gynecologic cancers. Also, SET appears to exert its activity through PP2A-dependent as well as PP2A-independent mechanisms. [review] PMID: 28356029
  4. SET overexpression is associated with GC progression. PMID: 28677734
  5. The results demonstrate that NFkB plays an important role in regulation of the human SET gene expression. PMID: 27351675
  6. SET accumulation is implicated in epigenetic modifications, such as DNA hypomethylation and histone hypoacetylation. It is associated with gene expression regulation and chromatin organization, thereby affecting gene expression control, DNA damage repair, and genome instability. PMID: 28460463
  7. Data show that PP32 and SET/TAF-Ibeta proteins block HAT1-mediated H4 acetylation. PMID: 28977641
  8. SEToverexpression promotes morphological and oncogenic cell transformation of an oral keratinocyte cell. PMID: 28636114
  9. Overexpression of SET-Nup214 in HeLa cells leads to the formation of similar nuclear bodies that recruit CRM1, export cargo proteins, and certain nucleoporins and concomitantly affect nuclear protein and poly(A)(+) RNA export. PMID: 27613868
  10. Molecular chaperone SET-assisted eviction of linker histones and Shugoshins is a fundamental step in mammalian mitotic progression. PMID: 28781233
  11. Our findings suggested the oncogenic role of SET and the adverse prognostic value of SET overexpression in hepatocellular carcinoma (HCC). This alteration defines a subgroup of HCC patients who could benefit from SET antagonists, such as EMQA. PMID: 26876205
  12. This review summarizes and discusses the general mechanisms of H3K4 methylation, and how the six main enzymes from the SET/MLL family (responsible for H3K4me1/me2/me3) function in hematopoiesis and in hematologic malignancies. [review] PMID: 27796741
  13. identification of the oncoprotein SET as a major cellular factor whose binding with p53 is dependent on C-terminal domain acetylation status PMID: 27626385
  14. The findings of the present study suggested that the SET gene may contribute to tumorigenesis and may be a potential novel effective therapeutic target for leukemia and other cancer types. PMID: 27035430
  15. Data indicate that SET protein as a direct target of microRNA miR-125b, and the downregulation of SET, observed during tumor migration, was affected by the overexpression of miR125b. PMID: 27383536
  16. significance of SET/I2PP2A-mediated PP2A and non-PP2A pathways in polycystic ovary syndrome PMID: 27836688
  17. Both SET protein levels (and BACE1) were increased in Down syndrome patients. PMID: 24935721
  18. SET interacts with the Kruppel-associated box (KRAB)-associated co-repressor KAP1, and its overexpression results in the sustained retention of KAP1 and Heterochromatin protein 1 (HP1) on chromatin PMID: 25818296
  19. the results of the present study demonstrated that SET was associated with paclitaxel resistance in MCF-7/PTX cells, and that paeonol reversed paclitaxel resistance in MCF-7/PTX cells by downregulating the activity of the SET/PP2A/Akt pathway. PMID: 25760096
  20. These findings establish a framework for understanding the molecular basis of cytochrome c-mediated blocking of SET/TAF-Ibeta. PMID: 26216969
  21. Low SET expression is associated with bone metastasis in renal cell carcinoma. PMID: 26115722
  22. SET overexpression is a frequent event in metastatic colorectal cancer that plays a potential oncogenic role associated with worse outcome and resistance to oxaliplatin. PMID: 25388166
  23. A functional link between SET-mediated NDRG1 regulation. PMID: 25152373
  24. Therefore, SET overexpression in HEK293 cells promotes mitochondrial fission and reduces autophagic flux in apparent association with up-regulation of UCP2 and UCP3. PMID: 25656576
  25. The stable suppression of SET through RNA interference inhibited the growth, migration and invasion of breast cancer cells. Knockdown of SET increased the activity and expression of PP2Ac and decreased the expression of matrix metalloproteinase 9. PMID: 25234598
  26. Data indicate a therapeutic paradigm of inhibitor-2 of protein phosphatase-2A (SET) antagonism using OP449 in combination with tyrosine kinase inhibitors for the treatment of chronic myeloid leukemia (CML) and acute myeloid leukemia (AML) cell lines. PMID: 24436473
  27. Inactivation of nuclear localization signal causes retention of I2PP2A in the cell cytoplasm, where it promotes Tau hyperphosphorylation by affecting PP2A signaling. PMID: 25128526
  28. SET/TAF-Ibeta inhibits FoxO1 acetylation and activates its transcriptional activity toward p21 PMID: 24983498
  29. SET accumulation has important actions in head and neck squamous cell carcinoma PMID: 24555657
  30. SET/TAF-Ibeta interacts with Ku70/80 in the nucleus and inhibits Ku70 acetylation. PMID: 24305947
  31. SET is overexpressed in about 50-60% and CIP2A in about 90% of breast cancers. PMID: 24927563
  32. Set-beta differentially regulates axon growth and regeneration depending on subcellular localization and phosphorylation. PMID: 24849368
  33. C6-ceramide inhibits I2PP2A mediated upregulation of c-Myc and downregulation of histone acetylation in prostate cancer cells. PMID: 24025258
  34. When compared with SET-NUP214-negative patients, SET-NUP214-positive patients showed a significantly higher rate of corticosteroid resistance (91% vs 44%; P = .003) and chemotherapy resistance (100% vs 44%; P = .0001). PMID: 24449214
  35. Data show that SET accumulation up-regulated hnRNPK mRNA and total/phosphorylated protein, promoted hnRNPK nuclear location, and reduced Bcl-x mRNA levels. PMID: 24508256
  36. Detention of cytoplasmic SET protein occurs with Ser9 phosphorylation in Alzheimer's disease. PMID: 23374587
  37. TAF-Ibeta promotes BZLF1 expression and subsequent lytic infection by affecting chromatin at the BZLF1 promoter PMID: 23691099
  38. Recombinant SET with phosphorylation-mimic Ser171 to Glu substitution reduced its inhibitory effects on PP2A phosphatase activity compared with Ser171 to Ala substituted or wild-type SET PMID: 23251465
  39. SET is potential marker for head and neck squamous cell carcinoma associated with cancer cell resistance PMID: 22739068
  40. SET protein interacts with intracellular domains of the gonadotropin-releasing hormone receptor and differentially regulates receptor signaling to cAMP and calcium in gonadotrope cells PMID: 23233674
  41. A SET mutant, lacking a nuclear localization signal, SET(DeltaNLS), promotes cell spreading and motility. This was accompanied by an increase in the number and frequency of membrane ruffles. PMID: 23195690
  42. SET downregulated repair genes ATM, BRCA1 and CHEK2 and upregulated TP53 PMID: 23106910
  43. SET/TAF-Ibeta is sequentially recruited to the target gene promoter ATF3 after the PRC2 complex via H3K27me recognition and may offer additive effects in the repression of the target gene. PMID: 22796192
  44. SET knockdown increased high-affinity binding of agonist in intact cells and membrane preparations. PMID: 22466417
  45. Results showed that SET is significantly overexpressed in pediatric acute lymphoblastic leukemia samples, and an increased level of SET might contribute to leukemic process. PMID: 22677993
  46. SET overexpression is a key mechanism in the inhibition of PP2A in acute myeloid leukemia. PMID: 22133779
  47. Suggest that accumulated SET could act via Akt/PTEN either as cell survival signal or as oxidative stress sensor for cell death. PMID: 22143534
  48. Data describe the relatively high incidence of SET-NUP214 rearrangement in adult T-ALLs, and demonstrate comprehensive clinical, phenotypic, and genetic characteristics of this entity. PMID: 21720744
  49. crystals of template-activating factor Ibeta diffracted to 2.7 A resolution and belonged to space group P4(3)2(1)2. PMID: 20693670
  50. TAF-I is a key molecule that regulates linker histone-mediated chromatin assembly and disassembly PMID: 21940793

Show More

Hide All

Involvement in disease
A chromosomal aberration involving SET is found in some cases of acute undifferentiated leukemia (AUL). Translocation t(6;9)(q21;q34.1) with NUP214/CAN.
Subcellular Location
Cytoplasm, cytosol. Endoplasmic reticulum. Nucleus, nucleoplasm. Note=In the cytoplasm, found both in the cytosol and associated with the endoplasmic reticulum. The SET complex is associated with the endoplasmic reticulum. Following CTL attack and cleavage by GZMA, moves rapidly to the nucleus, where it is found in the nucleoplasm, avoiding the nucleolus. Similar translocation to the nucleus is also observed for lymphocyte-activated killer cells after the addition of calcium.
Protein Families
Nucleosome assembly protein (NAP) family
Tissue Specificity
Widely expressed. Low levels in quiescent cells during serum starvation, contact inhibition or differentiation. Highly expressed in Wilms' tumor.
Database Links

HGNC: 10760

OMIM: 600960

KEGG: hsa:6418

STRING: 9606.ENSP00000361777

UniGene: Hs.436687

CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1