Recombinant Human Ras-related protein Rab-5C(RAB5C)

Code	CSB-EP019215HU
Size	US$1726
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Target Data

Product Details

Purity	Greater than 90% as determined by SDS-PAGE.
Target Names	RAB5C
Uniprot No.	P51148
Research Area	Signal Transduction
Alternative Names	L1880; RAB; member of RAS oncogene family like ; RAB5C; RAB5C; member of RAS oncogene family; RAB5C; member RAS oncogene family; RAB5C_HUMAN; RAB5CL; RAB5L; RABL; Ras-related protein Rab-5C
Species	Homo sapiens (Human)
Source	E.coli
Expression Region	1-216aa
Target Protein Sequence	MAGRGGAARPNGPAAGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNTDTFARAKNWVKELQRQASPNIVIALAGNKADLASKRAVEFQEAQAYADDNSLLFMETSAKTAMNVNEIFMAIAKKLPKNEPQNATGAPGRNRGVDLQENNPASRSQCCSN Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight	39.5kDa
Protein Length	Full Length
Tag Info	N-terminal 6xHis-SUMO-tagged
Form	Liquid or Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Note: If you have any special requirement for the glycerol content, please remark when you place the order. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs	Protein FAQs
Storage Condition	Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time	Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA	Please contact us to get it.

Target Data

Function	Protein transport. Probably involved in vesicular traffic (By similarity).
Gene References into Functions	We identify RAB5C as a new candidate gene for type-2 diabetes risk with a functional role in endosomal type-2 diabetes module. Functional analysis shows that RAB5C is tyrosine phosphorylated. Data analysis reveals a tyrosine phosphorylation motif in the GTP binding site of RAB5C which may be targeted by insulin receptor. Insulin-dependent tyrosine phosphorylation of RAB5C is inhibited by overexpression of HACD3 (PTPLAD1). PMID: 30300385 Enforced miR-509 expression in NALM6 cells reduced RAB5C mRNA and protein levels, and RAB5C was demonstrated to be a direct target of miR-509. PMID: 25368993 PLP2 and RAB5C are binding partners of TPD52. PMID: 24604726 Rab5C modulates Rac1-mediated cell motility. PMID: 24587345 GTP-Rab5c also bound to AMAP1, and activation of Rab5c by EGFR signaling was necessary to promote the intracellular association of AMAP1 and PRKD2 PMID: 22734003 Show More Hide All
Subcellular Location	Cell membrane, Lipid-anchor, Cytoplasmic side, Early endosome membrane, Lipid-anchor, Melanosome
Protein Families	Small GTPase superfamily, Rab family
Database Links	HGNC: 9785 OMIM: 604037 KEGG: hsa:5878 STRING: 9606.ENSP00000345689 UniGene: Hs.650382