Your Good Partner in Biology Research
Tel : 301-363-4651
Your Good Partner in Biology Research
| Code | CSB-EP019215HU |
| Product Type | Recombinant Protein |
| Size | US$1726 |
| Uniprot No. | P51148 |
| Relevance | Protein transport. Probably involved in vesicular traffic . |
| Image |
|
| Storage Buffer | Tris-based buffer,50% glycerol |
| Alias | L1880RAB5L |
| Species | Homo sapiens (Human) |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Sequence | MAGRGGAARPNGPAAGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNTDTFARAKNWVKELQRQASPNIVIALAGNKADLASKRAVEFQEAQAYADDNSLLFMETSAKTAMNVNEIFMAIAKKLPKNEPQNATGAPGRNRGVDLQENNPASRSQCCSN |
| Research Area | Signal Transduction |
| Source | E.coli |
| Gene Names | RAB5C |
| Protein Names | Recommended name: Ras-related protein Rab-5C Alternative name(s): L1880 RAB5L |
| Expression Region | 1-216aa |
| Tag Info | N-terminal 6xHis-SUMO-tagged |
| Mol. Weight | 39.5kDa |
| Protein Description | Full Length |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Still Have Questions? | Leave a Message or Start an on-line Chat |
| Function | Protein transport. Probably involved in vesicular traffic (By similarity). |
| Subcellular Location | Cell membrane, Lipid-anchor, Cytoplasmic side, Early endosome membrane, Lipid-anchor, Melanosome |
| Protein Families | Small GTPase superfamily, Rab family |
| Database Links |
HGNC: 9785 OMIM: 604037 KEGG: hsa:5878 STRING: 9606.ENSP00000345689 UniGene: Hs.650382 |
| Pathway |
Ras signaling pathway
Endocytosis |
RAB5C Antibodies for Homo sapiens (Human)
| Code | Product Name | Species Reactivity | Application |
|---|---|---|---|
| CSB-PA040136 | RAB5C Antibody | Human,Mouse,Rat | WB,IHC,ELISA |
| CSB-PA041280 | RAB5C Antibody | Human,Mouse | ELISA,WB |
| CSB-PA097939 | RAB5C Antibody | Human,Mouse | ELISA,WB |
RAB5C Antibodies for Human
| Code | Product Name | Species Reactivity | Application |
|---|---|---|---|
| CSB-PA019215DSR1HU | RAB5C Antibody | Human | ELISA, IHC |
| CSB-PA019215DSR2HU | RAB5C Antibody | Human | ELISA, IHC |
RAB5C Proteins for Homo sapiens (Human)
| Code | Product Name | Source |
|---|---|---|
| CSB-YP019215HU CSB-BP019215HU CSB-MP019215HU |
Recombinant Human Ras-related protein Rab-5C(RAB5C) | Yeast Baculovirus Mammalian cell |
Recombinant Human X-ray repair cross-complementing protein 5(XRCC5),partial
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Transcriptional enhancer factor TEF-1(TEAD1)
Express system: Yeast
Species: Homo sapiens (Human)
Recombinant Rabbit Serum amyloid A-1 protein(SAA1)
Express system: E.coli
Species: Oryctolagus cuniculus (Rabbit)
Recombinant Mouse Ubiquitin-protein ligase E3A(Ube3a),partial
Express system: Yeast
Species: Mus musculus (Mouse)
