Purity
Greater than 90% as determined by SDS-PAGE.
Research Area
Signal Transduction
Alternative Names
L1880; RAB; member of RAS oncogene family like ; RAB5C; RAB5C; member of RAS oncogene family; RAB5C; member RAS oncogene family; RAB5C_HUMAN; RAB5CL; RAB5L; RABL; Ras-related protein Rab-5C
Species
Homo sapiens (Human)
Expression Region
1-216aa
Target Protein Sequence
MAGRGGAARPNGPAAGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNTDTFARAKNWVKELQRQASPNIVIALAGNKADLASKRAVEFQEAQAYADDNSLLFMETSAKTAMNVNEIFMAIAKKLPKNEPQNATGAPGRNRGVDLQENNPASRSQCCSN
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
Amino acids 1-216 constitute the expression domain of recombinant Human RAB5C. The theoretical molecular weight of the RAB5C protein is 39.5 kDa. Expression of this RAB5C protein is conducted in e.coli. The RAB5C coding gene included the N-terminal 6xHis-SUMO tag, which simplifies the detection and purification processes of the recombinant RAB5C protein in following stages of expression and purification.
Ras-related protein Rab-5C (RAB5C) belongs to the Rab family of small GTPases that play crucial roles in regulating intracellular vesicle trafficking and membrane fusion events. Specifically, RAB5C is associated with the early endosomal compartment and is involved in controlling endocytosis, vesicle fusion, and membrane trafficking. The main function of RAB5C is to regulate the dynamics of early endosomes, which are essential for the sorting and processing of internalized cargo. It facilitates the fusion of early endosomes with other vesicles and organelles, contributing to the coordination of cellular transport processes. Research areas related to RAB5C often focus on understanding its role in endocytic pathways, intracellular signaling, and membrane trafficking events. Investigating the molecular mechanisms underlying RAB5C function provides insights into fundamental cellular processes and may have implications for various physiological and pathological conditions, including the regulation of receptor internalization, signal transduction, and membrane homeostasis.