Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

POP7

Uniprot No.

O75817

Research Area

Epigenetics and Nuclear Signaling

Alternative Names

0610037N12Rik; hPOP7; POP7 (processing of precursor, S. cerevisiae) homolog; POP7; POP7_HUMAN; processing of precursor 7 ribonuclease P subunit (S. cerevisiae); processing of precursor 7, S. cerevisiae, homolog of; Ribonuclease P protein subunit p20; Ribonuclease P, 20-KD subunit; Ribonucleases P/MRP protein subunit POP7 homolog; RNaseP protein p20; RPP2; RPP20

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

1-140aa

Target Protein Sequence

MAENREPRGAVEAELDPVEYTLRKRLPSRLPRRPNDIYVNMKTDFKAQLARCQKLLDGGARGQNACSEIYIHGLGLAINRAINIALQLQAGSFGSLQVAANTSTVELVDELEPETDTREPLTRIRNNSAIHIRVFRVTPK
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

42.7kDa

Protein Length

Full Length

Tag Info

N-terminal GST-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Explore the fascinating field of epigenetics and nuclear signaling with our Recombinant Human POP7 protein. As a ribonuclease P protein subunit p20 (RNaseP protein p20), POP7 is an essential component of the ribonuclease P complex, which plays a critical role in the processing of precursor tRNAs and other RNA molecules. Its involvement in RNA processing and maturation makes POP7 a key protein to study in the context of epigenetics and nuclear signaling research.

Our Recombinant Human POP7 protein is expressed in E.coli, yielding a full-length protein (1-140aa) that retains native structure and function. The N-terminal GST-tagged design allows for efficient purification and easy detection of the protein. With a purity greater than 85% as determined by SDS-PAGE, our Recombinant Human POP7 protein ensures reliable and consistent results for your research endeavors. Available in both liquid and lyophilized powder forms, our Recombinant Human POP7 protein is a valuable tool for advancing your studies in epigenetics and nuclear signaling.

Target Background

Function

Component of ribonuclease P, a ribonucleoprotein complex that generates mature tRNA molecules by cleaving their 5'-ends. Also a component of the MRP ribonuclease complex, which cleaves pre-rRNA sequences.

Gene References into Functions

analyses of interactions with deletion mutant proteins indicate that the Alba-type core domain of both Rpp20 and Rpp25 contains most of the determinants for mutual association and P3 RNA recognition. PMID: 20215441

Subcellular Location

Nucleus, nucleolus. Cytoplasm. Cytoplasmic granule.

Protein Families

Histone-like Alba family

Database Links

HGNC: 19949

OMIM: 606113

KEGG: hsa:10248

STRING: 9606.ENSP00000304353

UniGene: Hs.416994

Code	CSB-EP018375HU
Abbreviation	Recombinant Human POP7 protein
MSDS	MSDS Datasheet
Size	$224
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Ribonuclease P protein subunit p20 (POP7)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage