Recombinant Human Ribonuclease P protein subunit p20 (POP7)

Code CSB-EP018375HU
Abbreviation Recombinant Human POP7 protein
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
POP7
Uniprot No.
Research Area
Epigenetics and Nuclear Signaling
Alternative Names
0610037N12Rik; hPOP7; POP7 (processing of precursor, S. cerevisiae) homolog; POP7; POP7_HUMAN; processing of precursor 7 ribonuclease P subunit (S. cerevisiae); processing of precursor 7, S. cerevisiae, homolog of; Ribonuclease P protein subunit p20; Ribonuclease P, 20-KD subunit; Ribonucleases P/MRP protein subunit POP7 homolog; RNaseP protein p20; RPP2; RPP20
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-140aa
Target Protein Sequence
MAENREPRGAVEAELDPVEYTLRKRLPSRLPRRPNDIYVNMKTDFKAQLARCQKLLDGGARGQNACSEIYIHGLGLAINRAINIALQLQAGSFGSLQVAANTSTVELVDELEPETDTREPLTRIRNNSAIHIRVFRVTPK
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
42.7kDa
Protein Length
Full Length
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Explore the fascinating field of epigenetics and nuclear signaling with our Recombinant Human POP7 protein. As a ribonuclease P protein subunit p20 (RNaseP protein p20), POP7 is an essential component of the ribonuclease P complex, which plays a critical role in the processing of precursor tRNAs and other RNA molecules. Its involvement in RNA processing and maturation makes POP7 a key protein to study in the context of epigenetics and nuclear signaling research.

Our Recombinant Human POP7 protein is expressed in E.coli, yielding a full-length protein (1-140aa) that retains native structure and function. The N-terminal GST-tagged design allows for efficient purification and easy detection of the protein. With a purity greater than 85% as determined by SDS-PAGE, our Recombinant Human POP7 protein ensures reliable and consistent results for your research endeavors. Available in both liquid and lyophilized powder forms, our Recombinant Human POP7 protein is a valuable tool for advancing your studies in epigenetics and nuclear signaling.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Component of ribonuclease P, a ribonucleoprotein complex that generates mature tRNA molecules by cleaving their 5'-ends. Also a component of the MRP ribonuclease complex, which cleaves pre-rRNA sequences.
Gene References into Functions
  1. analyses of interactions with deletion mutant proteins indicate that the Alba-type core domain of both Rpp20 and Rpp25 contains most of the determinants for mutual association and P3 RNA recognition. PMID: 20215441
Subcellular Location
Nucleus, nucleolus. Cytoplasm. Cytoplasmic granule.
Protein Families
Histone-like Alba family
Database Links

HGNC: 19949

OMIM: 606113

KEGG: hsa:10248

STRING: 9606.ENSP00000304353

UniGene: Hs.416994

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*