Recombinant Human Ryanodine receptor 3 (RYR3), partial

In Stock
Code CSB-EP020621HU
Abbreviation Recombinant Human RYR3 protein, partial
MSDS
Size $224
Order now
Image
  • Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Neuroscience
Alternative Names
Brain ryanodine receptor calcium release channel ; Brain ryanodine receptor-calcium release channel; Brain type ryanodine receptor; Brain-type ryanodine receptor; HBRR; Ryanodine receptor 3; RYR 3; RYR-3; RyR3; RYR3_HUMAN
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
3934-4181aa
Target Protein Sequence
DGKGIISKKEFQKAMEGQKQYTQSEIDFLLSCAEADENDMFNYVDFVDRFHEPAKDIGFNVAVLLTNLSEHMPNDSRLKCLLDPAESVLNYFEPYLGRIEIMGGAKKIERVYFEISESSRTQWEKPQVKESKRQFIFDVVNEGGEQEKMELFVNFCEDTIFEMQLASQISESDSADRPEEEEEDEDSSYVLEIAGEEEEDGSLEPASAFAMACASVKRNVTDFLKRATLKNLRKQYRNVKKMTAKELV
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
32.5kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Calcium channel that mediates the release of Ca(2+) from the sarcoplasmic reticulum into the cytoplasm in muscle and thereby plays a role in triggering muscle contraction. May regulate Ca(2+) release by other calcium channels. Calcium channel that mediates Ca(2+)-induced Ca(2+) release from the endoplasmic reticulum in non-muscle cells. Contributes to cellular calcium ion homeostasis. Plays a role in cellular calcium signaling.
Gene References into Functions
  1. a genome-wide linkage scan and regional association fine-mapping identified variants in the RYR3 gene as a quantitative trail locus for plasma adiponectin levels in Chinese population PMID: 27858853
  2. Data show that the common variant single-nucleotide polymorphism rs2229116 of the ryanodine receptor 3 gene (RYR3) was significantly associated with carotid intima-media thickness (cIMT). PMID: 25500725
  3. SNPs within the RYR3 region were associated with subclinical atherosclerosis among HIV-infected women. Allelic heterogeneity observed across the three races suggests that the contribution of the RYR3 gene to CCA cIMT is complex. PMID: 24561552
  4. rs877087 and rs2229116 of RYR3 gene are associated with atherosclerosis severity in Japanese. PMID: 24423397
  5. a genetic interaction between the RYR3 and CACNA1C genes explained variance in amyloid deposition above and beyond other major known risk factors for late-onset Alzheimer's disease PMID: 24026422
  6. The findings reported here for the case-only analysis of the antihypertensive pharmacogenetic effect of RYR3 among 3058 CHD cases . PMID: 22664477
  7. the rectified RyR3 channel in open conformation may be regulated in situ by two cytosolic activating Ca(2+) sites PMID: 24211435
  8. The current study suggests that the functional variant (rs1044129) in the miR-367 binding site of RYR3 may be a potential marker for prognosis in patients following curative surgery for colorectal cancer PMID: 23393343
  9. RYR3 gene polymorphisms are associated with common carotid intima-media thickness in HIV-infected white males. PMID: 22627881
  10. Alterations in RyR3 expression at early disease stages may reflect the onset of pathologic mechanisms leading to later neurodegeneration. PMID: 21531043
  11. A putative binding site for microRNA-367 exists in the 3'UTR of RYR3, and a genetic variant, rs1044129 A-->G, is present in this binding region. PMID: 21810988
  12. smooth muscle RYR3 may function as a suppressor of RyR2-mediated Ca2+ release by forming heteromeric channels with a decreased sensitivity to activation by luminal Ca2+ PMID: 12213830
  13. essential in the sustained Ca(2+) response in T cells PMID: 12354756
  14. smooth muscle tissues express a major dominant negative splice variant of the type 3 Ca2+ release channel (ryanodine receptor) PMID: 12471029
  15. RNase protection assay and in situ hybridization revealed that RYR2 mRNA expresses widely in the heart including the SA-node, while RYR3 mRNA expression is limited to the SA-node and to the right atrium. PMID: 14550562
  16. the central binding site for the 12 kDa FK506-binding protein of type-3 ryanodine receptor, encompassing the critical valine proline motif, plays a crucial role in the modulation of the Ca2+ release properties PMID: 14970260
  17. We genotyped 14 tag SNPs in 166 Japanese patients with autism and 375 controls. PMID: 18588595
  18. Upregulation of the expression of ryanodine receptor 3 is suggestive of an intracellular calcium leak. PMID: 19581603
  19. This is the first published report on RyR3 and also establishes the first evidence of wide expression of the RyR3 gene. PMID: 1320290
  20. RyR3 is expressed in all murine skeletal muscles during the post-natal phase of muscle development and in fewer muscles in adult mice. In agreement, RyR3 KO mice present impaired contractility during the first weeks after birth but not in adult life. PMID: 9384575
  21. RyR3 KO mice show changes in hippocampal synaptic plasticity and a reduced flexibility in re-learning a new target in the water-maze. In the open-field, KO mice displayed a normal exploration and habituation, but had an increased speed of locomotion. PMID: 10508160

Show More

Hide All

Subcellular Location
Sarcoplasmic reticulum membrane; Multi-pass membrane protein. Membrane; Multi-pass membrane protein. Microsome membrane; Multi-pass membrane protein. Sarcoplasmic reticulum.
Protein Families
Ryanodine receptor (TC 1.A.3.1) family, RYR3 subfamily
Tissue Specificity
Brain, skeletal muscle, placenta and possibly liver and kidney. In brain, highest levels are found in the cerebellum, hippocampus, caudate nucleus and amygdala, with lower levels in the corpus callosum, substantia nigra and thalamus.
Database Links

HGNC: 10485

OMIM: 180903

KEGG: hsa:6263

STRING: 9606.ENSP00000373884

UniGene: Hs.709373

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*