Recombinant Human SWI/SNF complex subunit SMARCC1 (SMARCC1), partial

Code CSB-BP821715HU
Abbreviation Recombinant Human SMARCC1 protein, partial
MSDS
Size $528
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
SMARCC1
Uniprot No.
Research Area
Neuroscience
Alternative Names
AI115498; BAF 155; BAF155; BRG 1 associated factor 155; BRG1 associated factor 155; BRG1-associated factor 155; Chromatin remodeling complex BAF155 subunit; CRACC 1; CRACC1; Mammalian chromatin remodeling complex BRG 1 associated factor 155; Mammalian chromatin remodeling complex BRG1 associated factor 155; Rsc 8; Rsc8; SMARC C1; SMARCC 1; SMARCC1; SMRC1_HUMAN; SRG 3; SRG3; SWI 3; SWI/SNF complex 155 kDa subunit; SWI/SNF complex subunit SMARCC1; SWI/SNF related matrix associated actin dependent regulator of chromatin c1; SWI/SNF related matrix associated actin dependent regulator of chromatin subfamily c member 1; SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily C member 1; SWI3
Species
Homo sapiens (Human)
Source
Baculovirus
Expression Region
451-671aa
Target Protein Sequence
IPSYASWFDYNCIHVIERRALPEFFNGKNKSKTPEIYLAYRNFMIDTYRLNPQEYLTSTACRRNLTGDVCAVMRVHAFLEQWGLVNYQVDPESRPMAMGPPPTPHFNVLADTPSGLVPLHLRSPQVPAAQQMLNFPEKNKEKPVDLQNFGLRTDIYSKKTLAKSKGASAGREWTEQETLLLLEALEMYKDDWNKVSEHVGSRTQDECILHFLRLPIEDPYL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
27.5kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Involved in transcriptional activation and repression of select genes by chromatin remodeling (alteration of DNA-nucleosome topology). Component of SWI/SNF chromatin remodeling complexes that carry out key enzymatic activities, changing chromatin structure by altering DNA-histone contacts within a nucleosome in an ATP-dependent manner. May stimulate the ATPase activity of the catalytic subunit of the complex. Belongs to the neural progenitors-specific chromatin remodeling complex (npBAF complex) and the neuron-specific chromatin remodeling complex (nBAF complex). During neural development a switch from a stem/progenitor to a postmitotic chromatin remodeling mechanism occurs as neurons exit the cell cycle and become committed to their adult state. The transition from proliferating neural stem/progenitor cells to postmitotic neurons requires a switch in subunit composition of the npBAF and nBAF complexes. As neural progenitors exit mitosis and differentiate into neurons, npBAF complexes which contain ACTL6A/BAF53A and PHF10/BAF45A, are exchanged for homologous alternative ACTL6B/BAF53B and DPF1/BAF45B or DPF3/BAF45C subunits in neuron-specific complexes (nBAF). The npBAF complex is essential for the self-renewal/proliferative capacity of the multipotent neural stem cells. The nBAF complex along with CREST plays a role regulating the activity of genes essential for dendrite growth.
Gene References into Functions
  1. Study found SMARCC1 as a direct target of miR-202-5p and promoted the growth and metastasis of colorectal carcinoma (CRC) cells. Furthermore, SMARCC1 could reverse the inhibitory effect of miR-202-5p on growth and metastasis of CRC cells. PMID: 30144500
  2. our data showed that Swi3 strongly affects haem/oxygen-dependent activation of respiration gene promoters whereas Swi2 affects only the basal, haem-independent activities of these promoters. using computational analysis and RNAi knockdown, we showed that the mammalian Swi3 BAF155 and BAF170 regulate respiration in HeLa cells. PMID: 27190130
  3. Results show the secondary structure of SWIRM domain of BAF155 consists of five alpha-helices forming a typical histone fold for DNA interactions. PMID: 23996527
  4. we identify BAF155 as a substrate for arginine methyltransferase CARM1. PMID: 24434208
  5. Wwp2 acts as a ubiquitin ligase of SRG3. PMID: 24365151
  6. miR-320c regulates the resistance of pancreatic cancer cells to gemcitabine through SMARCC1. PMID: 23799850
  7. loss of BAF155 expression represents another mechanism for inactivation of SWI/SNF complex activity in the development in human cancer. PMID: 22139574
  8. Data show that the mechanism of BAF155-mediated stabilization of BAF57 involves blocking its ubiquitination by preventing interaction with TRIP12. PMID: 20829358
  9. protein levels of BAF155/170 dictate the maximum cellular amount of BAF57 PMID: 16199878
  10. Constitutive expression of SRG3 inhibits positive selection processes in T-cell receptor transgenic mice. PMID: 17513758
  11. An increased expression of SMARCC1 protein was found in prostate cancer positively correlated with tumour dedifferentiation, progression, metastasis and time to recurrence. PMID: 18581278
  12. patients with tumours displaying high levels of CBFB and SMARCC1 proteins had a significantly better overall survival rate than patients with low levels PMID: 19156145

Show More

Hide All

Subcellular Location
Nucleus. Cytoplasm.
Protein Families
SMARCC family
Tissue Specificity
Expressed in brain, heart, muscle, placenta, lung, liver, muscle, kidney and pancreas.
Database Links

HGNC: 11104

OMIM: 601732

KEGG: hsa:6599

STRING: 9606.ENSP00000254480

UniGene: Hs.476179

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*