Recombinant Human Saitohin (STH)

Code CSB-EP022827HU
Abbreviation Recombinant Human STH protein
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
STH
Uniprot No.
Research Area
Neuroscience
Alternative Names
STH; Saitohin
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-128aa
Target Protein Sequence
MSEGGGQVSCIFAAPTRLCRWPALIECGVNLTQPLCEWMIQVARDRTLSLAWEVASLLTLSSSEVGLEGVGTIWPSSYSSEESSRNGAEQGRQLSIEGPFQGQNCPSHPAAALPLPMRGESQATSCQV
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
29.7kDa
Protein Length
Full Length
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Gene References into Functions
  1. Saitohin Q7R polymorphism is associated with late-onset Alzheimer's disease susceptibility among caucasian populations. (Meta-analysis) PMID: 28211174
  2. Results showed a significant interaction effect of COMT and STH polymorphisms on cognitive performances, strengthening the involvement of STH in cognitive impairments, especially in the domains commonly impaired in schizophrenia PMID: 25283873
  3. The rs6203857 polymorphism of the saitohin gene is a genetic risk factor for Parkinson's disease. PMID: 25168738
  4. results of this meta-analysis suggested that MAPT_238bp/STH Q7R polymorphisms might modulate the risk of Parkinson's disease susceptibility PMID: 25305495
  5. These results suggest a possible contribution of STH gene products on the heterogeneity of core frontal executive functions deterioration in schizophrenia PMID: 22187337
  6. Single polymorphisms within the saitohin gene were associated with increased cognitive impairment and functional dependence persons with moderate-to-advanced Alzheimer disease. PMID: 21934306
  7. effect of Saitohin on Abl-mediated phosphorylation appears to be allele-specific, providing evidence for a new cellular function for STH PMID: 21769920
  8. STH polymorphisms play a possibly shared role with those of serotinin transporter 5-HTTLPR gene as a susceptibility factor for Alzheimer's disease and frontotemperal lobar dementia. PMID: 20852909
  9. Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator) PMID: 20852909
  10. a gene within an intron of the tau gene; Q7R polymorphism appears to be over-represented in the homozygous state in late onset Alzheimer's disease subjects PMID: 12032355
  11. The saitohin Q allele, a novel determinant of tau H1 haplotypes, may represent a causative factor involved in the determinism of several tauopathies, e.g., frontotemporal dementia. PMID: 12447938
  12. At the STH gene only a common polymorphic change was found. PMID: 12826737
  13. Increased risk of Alzheimer's disease associated with the STH RR genotype is limited to late-onset Alzheimer's disease. PMID: 12826738
  14. The R allele of STH is associated with the H2 haplotype of tau; no correlation is found between R allele frequency and Alzheimer's or Parkinson's disease. PMID: 12932819
  15. Saitohin interacts with peroxiredoxin 6, a unique member of that family that is bifunctional and the levels of which increase in Pick disease. PMID: 16186110
  16. We found no evidence that could support a major pathogenic role of STH and TAU haplotype in AD, FTD or PD. PMID: 16909000
  17. Q allele of STH gene is over-represented in a tested group of patients with Huntington disease and might be considered a risk factor for HD like diseases. PMID: 18300012
  18. Homozygous Q/Q of STH Q7R polymorphism was the only one genotype found in either LOAD group or controls. No R allele was detected in LOAD and control groups. PMID: 18396294
  19. The Saitohin Q7R polymorphism is unlikely to contribute significantly to Alzheimer's disease susceptibility of the Han population in south China. PMID: 18850062
  20. Observational study of gene-disease association. (HuGE Navigator) PMID: 18850062
  21. Observational study of gene-disease association. (HuGE Navigator) PMID: 18509094
  22. Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator) PMID: 18396294
  23. Observational study of genotype prevalence. (HuGE Navigator) PMID: 18300012
  24. Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator) PMID: 18307033
  25. Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator) PMID: 15136700
  26. Observational study of gene-disease association. (HuGE Navigator) PMID: 16603077
  27. Observational study of gene-disease association. (HuGE Navigator) PMID: 16909000

Show More

Hide All

Subcellular Location
Cytoplasm. Nucleus.
Tissue Specificity
Highest expression in placenta, muscle, fetal brain, and adult brain, with lower expression in heart, kidney, stomach, testis, and adrenal gland. In the central nervous system, highest expression is in temporal lobe, hypothalamus, medulla and spinal cord,
Database Links

HGNC: 18839

OMIM: 607067

KEGG: hsa:246744

STRING: 9606.ENSP00000443168

UniGene: Hs.661831

CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*